Conserved Protein Domain Family
PRK12802

?
PRK12802: PRK12802 
flagellin; Provisional
Statistics
?
PSSM-Id: 139237
View PSSM: PRK12802
Aligned: 12 rows
Threshold Bit Score: 266.744
Threshold Setting Gi: 115350212
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 104782830   1 MALTVNTNTTSLGVQKNLNRASDALSTSMTRLSSGLKINSAKDDAAGLQIATRMTSQIRGQTMAIKNANDGISIAQTAEG 80
gi 70729021    1 MALTVNTNVTSLNVQKNLNRASDALSTSMTRLSSGLKINSAKDDAAGLQIATRMTSQIRGQTMAIKNANDGISIAQTAEG 80
gi 115350212   1 -MLNINTNILSLTTQTNLSGSQSALSQAINRLSSGKRVNTAADDAAGLAISTTQTAAINALTQGVSNANNGISMIQTAAG 79
gi 170722866   1 MALTVNTNTTSLGVQKNLNKASDALSTSMTRLSSGLRINSAKDDAAGQQIANKLQTMVTGTTVAIKNANDGNSITQTAEG 80
gi 186477735   1 -MLNINTNIASLTAQNNLSGSQSALSQAINRLSSGKRVNTAADDAAGLAISTTQTASINALTQGAANANNGISMVQTTNG 79
gi 172059234   1 -MLNINTNILSLTTQTNLSGSQSALSQAINRLSSGKRVNTAADDAAGLAISTTQTAAINALTQGVANANNGISMIQTAAG 79
gi 78064820    1 -MLNINTNILSLTTQTNLSGSQSALSQAINRLSSGKRINTAADDAAGLAISTSQTAAINALTQGVANANNGISMIQTANG 79
gi 148546728   1 MALTVNTNTTSLGVQKNLNRASDALGTSMTRLSSGLKINSAKDDAAGLQIATRMTSQIRGQTMAIKNANDAISIAQTAEG 80
gi 77457754    1 MALTVNTNTTSLNVQKNLNRASDALSTSMQRLSSGLKINSAKDDAAGLQIATRMSSQIRGNTQAIQNANDGISVAQTAEG 80
gi 66046695    1 MALTVNTNVTSLSVQKNLSRASDALSTSMGRLSSGLKIMSSKDDAAGLNIATKINSQIKGQTMAIKNANDGMSIAQTAEG 80
gi 71733403    1 MALTVNTNVASLNVQKNLGRASDALSTSMTRLSSGLKINSAKDDAAGLQIATKITSQIRGQTMAIKNANDGMSLAQTAEG 80
gi 28869153    1 MALTVNTNVASLNVQKNLGRASDALSTSMTRLSSGLKINSAKDDAAGLQIATKITSQIRGQTMAIKNANDGMSLAQTAEG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 104782830  81 AMQEQTNILQRMRELALQSRNDSNSQTDRDALDKEFQSMLKEIDRIADSTQL-NGKNLLDGSAGAMTFQVGSNTGTANQI 159
gi 70729021   81 AMQESTNILQRMRELAVQSRNDSNGTQDRVALNKEFAQMSDELTRIAKSTNL-NGKNLIDGSAGTMTFQVGSNTGSTNQI 159
gi 115350212  80 ALQSTVDNLQRIRTLAVESGDGSLDSNARANLQAEVTTRLGEIDRVATQTTF-NGQTILSN-AGNVTFQVGASANQTVAV 157
gi 170722866  81 ALSEITNILQRMRELALQARNDSNGTTERAALNKEFAAKSDEITRIATSTTFgTSKQLLNGTAGTMEFQVGAMTGTSQIL 160
gi 186477735  80 ALQSIVDNLQRIRQLAVEAGDGSLDSNALANLQSEVSTRLTEITRVAQQTTF-NGQAVLNG-IGSVNFQIGAFNGQQITA 157
gi 172059234  80 ALQSTVDNLQRIRTLAVESGDGSLDSNARANLQAEVTTRLGEIDRVATQTTF-NGQTILSN-AGNVTFQVGASANQTVAV 157
gi 78064820   80 ALQSTVDNLQRIRTLAQQAGDGSLDSSARANLQAEVTTRLGEIDRVASQTTF-NSQTILGG-TGSVTFQIGAAANQVVTV 157
gi 148546728  81 AMQEQTNILQRMRELAVQSRNDNNSEADRDALDKEFQSMLKEIDRIAGSTQL-NGKNLLDGSASDMTFQVGSNTGSDNQI 159
gi 77457754   81 ALQASTDILQRMRELAVKARNGTNGTADQTATNAEFAQMSDEITRISAATNL-NGKNLLDGSAGTVTLQVGANTGSANHI 159
gi 66046695   81 ALQESTNILQRMRELAVQSRNDSNSATDRVALNKEFTQMSSELTRIANSTNL-NGKNLIDGSASTMTFQVGSNSGASNQI 159
gi 71733403   81 ALQESTNILQRMRELAVQSRNDSNSSTDRDALNKEFTAMSSELTRIAQSTNL-NGKNLLDGSASTMTFQVGSNSGASNQI 159
gi 28869153   81 ALQESTNILQRMRELAVQSRNDSNSATDREALNKEFTAMSSELTRIAQSTNL-NGKNLLDGSASTMTFQVGSNSGASNQI 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 104782830 160 TITLSAAMKTTGTGAALTALagksITGANSTAAEATFSAAMDAIGSALDAINATRADLGANQNRLTSTINNLQNINENAE 239
gi 70729021  160 TITLDSGFDAATLGVDSGTIn---ITGNDSTTAETNTKAAMDAIDKALATINSSRADLGAAQNRLTSTISNLQNINENAS 236
gi 115350212 158 NFG-ATVWTSTGAGLSLSGL---------TVSDQTSAQSAITAIDTALKNVNTFQATLGAAQNTFQAAITTTQTQATNMS 227
gi 170722866 161 SVSMTSSFAASTLAVGTGTLa---ISGTSDSAVHTSVDAAITAIDAALQTVDTKKSDLGAIQNRFQSTINNLQSMNENSA 237
gi 186477735 158 NFG-SQKWDSGSLGVSGVSV-----------STASGAQAAMSTIDTVLTSVNTFQATLGATQNTFQAAISTTQTQATNMS 225
gi 172059234 158 NFG-ATVWTSTGAGLSLSGL---------TVSDQTSAQSAITAIDTALKNVNTFQATLGAAQNTFQAAITTTQTQATNMS 227
gi 78064820  158 DFG-TANWNSTGMSVNTLSV-----------ATQSGAQSAITAIDAALKQVNTFQATLGAAQNTFQAAISTTQTQATNMT 225
gi 148546728 160 TISLSDAMNTTGALSGLSGQs---ITGADSAAAEATFTAALSAIDDALNAINSTRADLGAVQNRLTSTINNLQNINENAE 236
gi 77457754  160 DLVLSGKFDAASLSVGSGTVv---LTGATSAAAASNIDNAITAIDAAIANINATRAALGASQNRLTSTISNLQNITENTT 236
gi 66046695  160 SLSLSASFDANTLGVGSAIT----IVGSDSAAAETNFSASIAAIDSALQTINNTRSDLGAAQNRLSSTISNLQNINENAS 235
gi 71733403  160 TLTLSASFDANTLGVGSAVT----IAGSDSTTAETNFSAAIAAIDSALQTINSTRADLGAAQNRLTSTISNLQNINENAS 235
gi 28869153  160 SLTLSASFDANTLGVGSAIS----ITGADSATSEAAFSAAVAAIDSALQTINSTRADLGAAQNRLTSTISNLQNINENAS 235
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 104782830 240 AARGRVQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLG 286
gi 70729021  237 AALGRVQDTDFAAETAQLTKQQTLQQASTAVLAQANQLPSAVLKLLQ 283
gi 115350212 228 AARSQITDADFATETANLSKAQVLQQAGISVLAQANSLPQQVLKLLQ 274
gi 170722866 238 AAMGRVQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLQ 284
gi 186477735 226 AARSQITDADFATETANLSKAQVLQQAGISVLAQANSMPQQVLKLLQ 272
gi 172059234 228 AARSQITDADFATETANLSKAQVLQQAGISVLAQANSLPQQVLKLLQ 274
gi 78064820  226 AARSQITDADFATETANLSKAQVLQQAGISVLAQANSLPQQVLKLLG 272
gi 148546728 237 AARGRVQDTDFAAETAQLTKQQTLQQASTSILAQANQLPSAVLKLLQ 283
gi 77457754  237 AAQGRVQDTDFAAETANLTKQQTLQQASTSVLAQANQLPSAVLKLLQ 283
gi 66046695  236 AALGRIQDTDFAAETAQLTKQQTLQQASTSILAQANQLPSAVLKLLQ 282
gi 71733403  236 AALGRVQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLQ 282
gi 28869153  236 AALGRVQDTDFAAETAQLTKQQTLQQASTSVLAQANQLPSAVLKLLQ 282
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap