Conserved Protein Domain Family
flgD

?
PRK12812: flgD 
flagellar basal body rod modification protein; Reviewed
Statistics
?
PSSM-Id: 139245
View PSSM: PRK12812
Aligned: 8 rows
Threshold Bit Score: 335.305
Threshold Setting Gi: 57237056
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 153952103   2 ATTNWNSNLNWTNTTNTNQTSDKATKADNSSSSSSSGvvSNPNATLDKDAFLKLLLVELQHQDPTDPMDSDKMLTQTSQL 81
gi 57237056    1 MISSSDWNLNTTATTSGTTSSGSTSGTTRTDSSSSSGivSNPNATLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQL 80
gi 121613172   1 MISSSDWNLNTTATTSGTTSSGSTSGTTRTDSSSSSGivSNPNATLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQL 80
gi 118475635   2 AINSMNNTATPTGTQFTTDKWAAQTEAEKLNNASGTG--TNPYSQLDKDAFLKLLLVELQYQDPTEPMDSAKMLEQTSQL 79
gi 218561734   1 MISSSDWNLNTTATTSGTTSSGSTSGTTRTDSSSSSGivSNPNATLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQL 80
gi 157414367   1 MISSSDWNLNTAATTSGTTSSGSTSGTTRTDSSSSSGivSNPNATLDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQL 80
gi 154174409   1 -----MTSVSDVTTKTTEARNAEKKAAAKQAATGTTG--ANPNSQLDKDAFMKLLLTELQYQDPTSPMDTEKMLTQTSQL 73
gi 157165774   1 -----MASVSDITTQTTQQKNAEKKANSRIDAAKGTG--TNPNSQLDKDAFMKLLLTELQHQDPTSPMDTEKMLTQTSQL 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 153952103  82 SALEMQQNTNTTMQKMVETMQklsdsfsASMSTSALGAIGKMATVNENKVKLTGADEVIALKMYLPEDSDDKgiTLEVYD 161
gi 57237056   81 SALEMQQNTNTTMQKMVETMQklsdsfsTSMSTSALGAIGKMATVSDNKIKLTGADELIALKMYLPEDSDENgvTLEIYD 160
gi 121613172  81 SALEMQQNTNTTMQKMVETMQklsdsfsTSMSTSALGAIGKMATVSDNKIKLTGADELIALKMYLPEDSDENgvTLEIYD 160
gi 118475635  80 ATLEMQENTNKVMKQLTTQMQ-------SSLSMTAMSALGKMANLS-NAVSKDTTTSSVDFSLYFPNDVKSG--SIQIYD 149
gi 218561734  81 SALEMQQNTNTTMQKMVETMQklsdsfsTSMSTSALGAIGKMATVSDNKIKLTGADELIALKMYLPEDSDENgvTLEIYD 160
gi 157414367  81 SALEMQQNTNTTMQKMVETMQklsdsfsTSMSTSALGAIGKMATVSDNKIKLTGADELIALKMYLPEDSDENgvTLEIYD 160
gi 154174409  74 AALEMQENTNSTMRQLVAQLQ-------SNANAYAISALGKMVSTGSNAVNITDDTKEISSALYFKTDATKG--KLEIKN 144
gi 157165774  74 ASVEMQENTNKAMKELVNQLK-------SNANAYAISALGKMVSTGSNAVTLTDEKKDAKFALYFKTDLANG--KIEVKN 144
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 153952103 162 KNNKLIfseKSNEGKEVSKGLFTLEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYPIEGIKFVAGVAYAKMGG 241
gi 57237056  161 SNNKLVf-sEKSDAKSISQGLFTMEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYPIEGVVFKDGVAYAKMAG 239
gi 121613172 161 SNNKLVf-sEKSDAKSISQGLFTMEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYPIEGVVFKDGVAYAKMAG 239
gi 118475635 150 SSENLV---KNIKFDELKSGINKFNWDGTDNNGDITLPGEYLIKATYTDTSGNSGESILGSYPVEAVKFVNGIAQIKIAG 226
gi 218561734 161 SNNKLVf-sEKSDAKSISQGLFTMEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYPIEGVVFKDGVAYAKMAG 239
gi 157414367 161 SNNKLVf-sEKSDAKSISQGLFTMEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYPIEGVVFKDGVAYAKMAG 239
gi 154174409 145 ANSQVV---RTIEFKDVAAGVSKIGWDGKDDAGNQVPNGSYTIEAQYVDKNGKSYTTQVGQYPVEAVKFVDGKAQIRIAG 221
gi 157165774 145 ANGQVV---RTTDLNETNAGVHNLAWDGKDASGNQVPNGSYTISATYTGKDGKEYKTQVGNYPVEAVKFVDGKAMMKVAG 221
                        250       260       270
                 ....*....|....*....|....*....|...
gi 153952103 242 QYVSFDDIGEISDYKLGLSSTSVGDSSSGDSSN 274
gi 57237056  240 QEVPFDAIQEITDYKLGSSSSTGGSGSSGDSSG 272
gi 121613172 240 QEVPFDAIQEITDYKLGSSSSTGGSGSSGDSSG 272
gi 118475635 227 EYVSMDKIREFTEPVKTTAVNNSNDSSNSNDSE 259
gi 218561734 240 QEVPFDAIQEITDYKLGSSSSTGGSGSSGDSSG 272
gi 157414367 240 QEVPFDAIQEITDYKLGSSSSTGGSGSSGDSSG 272
gi 154174409 222 EYVPMDKIAEFYEA------------------- 235
gi 157165774 222 EYVSMDKVSEYYEG------------------- 235
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap