Conserved Protein Domain Family
PRK12820

?
PRK12820: PRK12820 
bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional
Statistics
?
PSSM-Id: 105955
View PSSM: PRK12820
Aligned: 2 rows
Threshold Bit Score: 1421.3
Threshold Setting Gi: 116750786
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85858293   18 MDFSERVFCGHLTPDHTGRRVLLAGWVDAFRDHGGLLFIHLRDRNGIIQIVFSPEAASADVYRQAASLRAEYCVAVQGEV 97
gi 116750786   1 MAENDRSFCGNLSLSDVGSEVCLSGWVDALRDHGEVLFIHLRDRTGFIQAVFSPEHTPRRVYELASSLRSEFCVSLQGRV 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85858293   98 RKRLPGTENPHIETGDIEVFVSELTVLSESEALPFAISDKAMVAGASSAGADHVNEDLRMQYRYLDIRRPAMQKNLILRH 177
gi 116750786  81 QRRTEETENPHIETGKIEVMVRELSILAASVVLPFPISEKAMTAGGGSGRADAVSEDLRLQYRYLDLRRPSMQDHLAKRY 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85858293  178 RISQCVREFLDSRGFVEVETPVLTMSTPEGARDYLVPSRIHPRSFYALPQSPQLFKQLLMIGGMERYFQLARCFRDEDLR 257
gi 116750786 161 RIIKRARDFLDTRGFLEIETPILTKSTPEGARDYLVPSRVHPKEFYALPQSPQLFKQLLMMAGFERYFQVVRCFRDEDLR 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85858293  258 PNRQPEFTQLDIEASFIDEEFLYELIEELTVRMFAIGGIALSRPFPRMTYAEAMDTTGSDRPDLRFGLRMADVTGVFSRT 337
gi 116750786 241 PNRQPEFTQLDMEASFIDEEFIFELTEELVARMFEVGGIELPRPFPRMPYGEAMETYGSDRPDTRFDLKFIEATDIFENT 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85858293  338 SYSIFKQILQRGGSIKGINIKGQSEKLSKNVLQNEYAKEIAPSFGAKGMTWMRAEEGKLESNIVQFFSADELEALKRVFQ 417
gi 116750786 321 RYGIFKQILQRGGRIKGINVSGQSEKLSKNVLQNEYAKEIVPSFGAKGMTWMRVSAGGLDSNIVQFFSEEEKGAVLRRFH 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85858293  418 VEDGDVLIMVADPSCAIVNSALGQLRLHLGNRLGLIPEGVFYPVWITEFPLFEPTDEgGVTSSHHPFTAPDRTDFDPGNI 497
gi 116750786 401 ARDGDVILMIADASHDLVLSALGQLRLHLADRLGLIPPGVFHPLWVTDFPLFEATED-GVTSSHHPFTAPDRESFDPLDL 479
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85858293  498 EELLSLRSRAYDLVVNGEELGGGSIRINDREVQRRIFAALGLTEEDVKNKFGFFLRAFDFAAPPHGGLALGMDRVVSMIL 577
gi 116750786 480 QGLLDLRSRAYDLVVNGEELGGGSMRINKKDIQLRIFRALGLSEQEIEDKFGFFVRALDYGAPPHGGIALGLDRVVSMIL 559
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 85858293  578 QTPSIREVIAFPKNRSAACPLTGAPSEVKREQLAELGLLNLGDKDVLPGDAEKEDRIDHLSWVSRIGIAEGERPVMESIL 657
gi 116750786 560 RTPSIREVTAFPKNRSAYCPLTRAPSQVAQEQLRELGLTDMGEARQVRLLQERKELIDSLSWVSRIGFDEAERAAITTAL 639
                        650       660       670       680       690       700
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 85858293  658 AQAEELAAQVGDLAGNEEPVRSVAPVANRVREGLEAVRLSFSGTGRLLKNAPAVKGDYFKVAGILD 723
gi 116750786 640 ADAVRMVETLEGIDCDFEPLFSPVSAVYRMGEKMGARECSLAATGEILKNAPSVKGNYYKVASILE 705
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap