Conserved Protein Domain Family
ubiA

?
PRK12871: ubiA 
prenyltransferase; Reviewed
Statistics
?
PSSM-Id: 106000
View PSSM: PRK12871
Aligned: 5 rows
Threshold Bit Score: 435.784
Threshold Setting Gi: 126180357
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126180357   1 MRETLAAFADLTRAHFFFVWPLLFCSGLALAFANYGGFSWELVGRAALIGLFGFEAGFVLNDYVDREYDRRDVDGSLTRY 80
gi 73669199    1 MIETLKAYLDLIRAHFLPAWPLVSCSGLVLAFANYGGFSWALTIKVALIGLLGFEAGFILNDYVDRKRDRLDVENTLTRY 80
gi 21228044    1 MKETLKSYLDLTRAHFLPAWPLVFCSGLVLAFANYGGFSWELIIKAALIGLFGFEAGFVLNDYVDRNRDRLDVENTMTRY 80
gi 20089675   74 TKETIKALIDLTRAHFSLVWILLFYSGLVLAFKNYGEFSREITFKAVLIGLFGFEGGLVLNDYVDRKRDRLDVEGALTVY 153
gi 20089674   17 MKETLKAYIDLTRVHFLPAWPLIFCSGLVLAFANYGGFSWALILKAALIGLLGFEAGFVLNDYVDRNRDKLDVENTMTRY 96
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126180357  81 WRPFGERPIPAGKLSPGAAFAVFLVLAGLAAALAATLPSPHNLYVLGIMGYSYLVEYFYQTKKRNQTVPVAQMVGRTDFA 160
gi 73669199   81 WRPFKERPIPSGKVSSKNAFLLFILLVAVVSALILTLPYPNSLYVFVVMLYSYSIEAFYQIKKRNQNYPIAQLLGRTDFT 160
gi 21228044   81 WRPFKERPIPSGRISSKNAFWLFILLALVTSALIFTLPYPNSLYVFAIMLYSYGIEAFYQVKKRDQKLPVAQLLGRTDFT 160
gi 20089675  154 WRPFKSRPLPSGRLSPAFALALFLLFSALTGVLMLTLPFPNSLYVFITMLSSCIIEYFYQVKRKNQSFPVAQLVGRMDFT 233
gi 20089674   97 WRLFKERPIPSGKISSKNAFWLFILLVGVTSALIFTLPYPNSLYVFVIMLYSYGIEAFYQVKKRDQKYPVAQLLGRTDFT 176
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 126180357 161 LFPVAGYLVYGNPDATALLFFLFFYPWTLAHLGANDIADIVNDRARGMATIpsltfgltgsapedptPVLYGMKGAAAWV 240
gi 73669199  161 LFPAAGYLCYGHPDMTMLLYMFFFYPWTMAHLGLNDFIDLKNDRSRDMKSI----------------AVLYGEKGTMYWI 224
gi 21228044  161 LFPAAGYLCYGQPDMTILLYMVFFYPWTMAHLGLNDFIDLENDRAREMKSI----------------AVLYGAKGSMYWV 224
gi 20089675  234 LFPVAGYLCYGKPDTTLLLYLVFFYPWTLSHLAVNDFIDTENDRARGIKSI----------------PVLYGLEGTLFWI 297
gi 20089674  177 LFPAAGYLCYGQPDMTVLLYMVFFYPWTMAHLGLNDFIDLENDRARGMKSI----------------AVLYGSKGAMYWV 240
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 126180357 241 LGFSAIHAGMALVFGLTLGPIAIAGFGAGLILLGAANYLILRGKTADAAMRALPLMHASLLIYAAAIIAGAVL 313
gi 73669199  225 TGFTALHFLAAIFFLQELGEIAFYGFLVGFVLLAGANLYLWKEKNPGAGMKILPVYHGVLIIYAVSIILDFIY 297
gi 21228044  225 TGFTLLHFFMSIFFLRELGNIALYGFFAGFVLLAGSNLYLWREMSPGAGMKILPIYHSTLVIYAVSIILDFIY 297
gi 20089675  298 FGFTLLHYLAALLFLKQLGDIALYGFLLGFLVLGFANYKLLKEKSQRAGLFALFLFHVSLVLYSCSIIFDSFS 370
gi 20089674  241 TGFTVLHFLAAIFFLRELGTIALYGFLAGFVLLAGSNLYLWKEKSQDAGMKILPVYHMTLVIYSVSIILDFMY 313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap