Conserved Protein Domain Family
purU

?
PRK13010: purU 
formyltetrahydrofolate deformylase; Reviewed
Statistics
?
PSSM-Id: 139334
View PSSM: PRK13010
Aligned: 5 rows
Threshold Bit Score: 508.567
Threshold Setting Gi: 26988670
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 186472152   1 MPATDRHPQFALTLSCPSAAGQVAAIVGFLDRHHCYIDELTVFDDDISERFFVRCVFHgvgSAPDAALHIDTLRHEFRPI 80
gi 17545825    1 MDALSRSPSFILTLSCPSAPGQVAAVVGLLERHHCYIDELTVFDDDLNHRFFVRCVFH---PTDAHALPVDVLRQEFAPI 77
gi 15889735    1 ------MTSYVLTVACKSTRGIVAAISGYLAEKGCNIVDSSQFDDLETGKFFMRVSFI-----SEEGASLQAITEGFQPV 69
gi 71281589    2 SDIKPVSQTHIITADCPSRPGTVDVVTRFLCEKGFYINEIHSFDDTAVNRFFIRIEFR---AQTATDFSAETFSQEFEQR 78
gi 26988670    1 ---MNKNNQYVLSLACQDAPGIVSEVSTFLFNNGANIVEAEQFNDEDSSKFFMRVSVE------IPVAGVNDFNSAFGKV 71
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 186472152  81 AADFDMTWAMHDLEMRPKVLIMVSKLEHCLADLLFRWRMGELKMDIAGIASNHP-DFQPLAAQHGLPFHHFPLTPDTKAQ 159
gi 17545825   78 AEAFDMQWAIHDAQARPKVLIMVSKLEHCLADLLFRWRMGELKMDIVGIASNHP-DLEPLARQHDLPFRHFPIAPETKAQ 156
gi 15889735   70 SEKFGMASDIYPDGQRMKAMLMVSRFGHCLNDLLYRWKIGALPIDIVGVVSNHF-DYQKVVVNHDIPFHHIKVTKENKPK 148
gi 71281589   79 ASEFEMQWQLASSPYKSKVVIMVSKHDHCLNDLLYRYRTGDLDIEIPAIISNHP-DLEELAKWHGIPYYHLPITKDTKPE 157
gi 26988670   72 VEKYNAEWWFRPRTDRKKVVIMVSKFDHCLGDLLYRHRLGELDMEVVGIISNHPrEALSVSLVGDIPFHYLPVTPATKAA 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 186472152 160 QEAQILDLFDKSGAELMILARYMQILSDETSRKLSGRAINIHHSFLPGFKGARPYHQAHARGVKLIGATAHFVTDDLDEG 239
gi 17545825  157 QEAQWLDLFESSGAELVILARYMQVLSAQTSKKLVNRAINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHFVTDDLDEG 236
gi 15889735  149 AEAQLMDLIETSGTELVVLARYMQVLSDEMCRKMSGKIINIHHSFLPSFKGANPYKQAYERGVKLIGATAHYVTGDLDEG 228
gi 71281589  158 QEAKVWQIIQESDADLVVLARYMQVLSSDLCQKLSGKAINIHHSLLPGFKGARPYFQAYDRGIKLVGATAHYVSDDLDEG 237
gi 26988670  152 QESQIKNIVTQSQADLIVLARYMQILSDDLSAFLSGRCINIHHSFLPGFKGAKPYHQAHTRGVKLIGATAHFVTADLDEG 231
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|...
gi 186472152 240 PIIEQEVQRVDHSYGPERMLAVGRDVECITLARAVKAFVERRVFINGDRTVVL 292
gi 17545825  237 PIIEQVVERVDHSYRPEHLLAVGRDVECLTLARAVKAFIERRVFLNADRTVVF 289
gi 15889735  229 PIIEQDTVRVTHAQSAEDYVSLGRDVESQVLARAIHAHIHHRTFINGNRTVVF 281
gi 71281589  238 PIISQGVETVDHGYYPKDLAAKGRDIECLTLSRAVRCHIEHRIFMYGKKTVVF 290
gi 26988670  232 PIIAQDVEHVSHRDSAEDLVRKGRDIERRVLSRAVLLFLEDRLIVNGERTVVF 284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap