Conserved Protein Domain Family
PRK13031

?
PRK13031: PRK13031 
preprotein translocase subunit SecB; Provisional
Statistics
?
PSSM-Id: 106068
View PSSM: PRK13031
Aligned: 9 rows
Threshold Bit Score: 274.355
Threshold Setting Gi: 89255460
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 89255460    1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80
gi 56708747    1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80
gi 118496736   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80
gi 134302774   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80
gi 110671219   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80
gi 115313989   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80
gi 156501382   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80
gi 167626927   1 MDQQAQPQFQIQKVYVKDMSFSIPNSDKIWTTAWKPELHTDLKIEAINLPEENTYESILTLEVKVENEGIVAFEAEVKQA 80
gi 187932297   1 MDQQAQPQFQIQKVYVKDLSFSIPNSDKIWTTNWKPELHTDLKVEATKLPEENTYETVLTLEVKVENDGMVAFEAEVKQA 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 89255460   81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
gi 56708747   81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
gi 118496736  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
gi 134302774  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
gi 110671219  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
gi 115313989  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
gi 156501382  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
gi 167626927  81 GIFTVSNMQEAQIEHAKKAFCPNILYHYAREAISDLVSSGGFPQLCLSAVNFDAMYQDSLEKPADSKQH 149
gi 187932297  81 GIFTVANMQEAQIEHAKKAFCPNILYHYAREAISDLVISGGFPQLCLSAVNFDAMYQDSLKESADSKQH 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap