Conserved Protein Domain Family
PRK13037

?
PRK13037: PRK13037 
superantigen-like protein SSL1; Reviewed
Statistics
?
PSSM-Id: 106074
View PSSM: PRK13037
Aligned: 15 rows
Threshold Bit Score: 403.202
Threshold Setting Gi: 57651309
Created: 9-Dec-2010
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82750136    1 MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSESELKHYYNKPFFERKNVTGYKYTENGKDYMEVATDHQYYQI 80
gi 57651309    1 MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRI 80
gi 49482650    1 MKFKAIAKASLALGMLATGVITSNIQSVQAKTEVKQQSEADLKLYYNGPSFEYKKVTGYGFIEGKDRFIDFIYNGQYNKI 80
gi 88194180    1 MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRI 80
gi 21282111    1 MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSEADLKLYYNGPSFEYKKVTGYGFIEGKDRFIDFIYNGQYNKI 80
gi 151220600   1 MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRI 80
gi 87160089    1 MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRI 80
gi 148266883   1 MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSESELKHYYNKPVLERKNVTGYKYTEKGKDYIDVIVDNQYSQI 80
gi 156978750   1 MKFKAIAKASLALGMLATGVITSNVQSVQAKTEVKQQSESELKHYYNKPVLERKNVTGYKYTEKGKDYIDVIVDNQYSQI 80
gi 161508669   1 MKFKAIAKASLALGMLATGVITSNVQSVQAKAEVKQQSESELKHYYNKPILERKNVTGFKYTDEGKHYLEVTVGQQHSRI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82750136   81 SLLGPDKDKFKEGNNPGLDIFVVREGDSRQAANYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLK 160
gi 57651309   81 TLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLK 160
gi 49482650   81 SLVGSDKDKYNEEVNPDIDVFVVREGNGRQADNHSIGGVTKTNRGVYYDYIHSPILEIKKGNEEPQNSLYQIYKENISLK 160
gi 88194180   81 TLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLK 160
gi 21282111   81 SLVGSDKDKYNEEVNPDIDVFVVREGNGRQADNHSIGGITKTNRGVYYDYIHTPILEIKKGKEEPQSSLYQIYKEDISLK 160
gi 151220600  81 TLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLK 160
gi 87160089   81 TLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLK 160
gi 148266883  81 SLVGSDKDKFKDGDNSNIDVFILREGDSRQATNYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLK 160
gi 156978750  81 SLVGSDKDKFKDGDNSNIDVFILREGDSRQATNYSIGGVTKTNSQPFIDYIHTPILEIKKGKEEPQSSLYQIYKEDISLK 160
gi 161508669  81 TLLGSDKDKFKDGENSNIDVFILREGDSRQATNYSIGGVTKSNSVQYIDYINTPILEIKKDNEDVLKDFYYISKEDISLK 160
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 82750136  161 ELDFKLRKQLISQSGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGESIDGREIQKILVEIK 226
gi 57651309  161 ELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK 226
gi 49482650  161 ELDYRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK 226
gi 88194180  161 ELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK 226
gi 21282111  161 ELDFKLRKQLISQSGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGRQIQKILVEMK 226
gi 151220600 161 ELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK 226
gi 87160089  161 ELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK 226
gi 148266883 161 ELDYRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK 226
gi 156978750 161 ELDYRLRERAIKQHGLYSNGLKQGQITITMKDGKSHTIDLSQKLEKERMGDSIDGRQIQKILVEMK 226
gi 161508669 161 ELDYRLRERAIKQHGLYSNGLKQGQITITMNDGTTHTIDLSQKLEKERMGESIDGTKINKILVEMK 226
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap