Conserved Protein Domain Family
PRK13040

?
PRK13040: PRK13040 
superantigen-like protein SSL6; Reviewed
Statistics
?
PSSM-Id: 106077
View PSSM: PRK13040
Aligned: 6 rows
Threshold Bit Score: 323.214
Threshold Setting Gi: 88194186
Created: 9-Dec-2010
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21282116    1 MKLKALAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELINVDGLYRQHLTDKGAYVWKNLKDYY 80
gi 88194186    1 MKLKTLAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYF 80
gi 151220605   1 MKLKTLAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYF 80
gi 87160396    1 MKLKTLAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYF 80
gi 49485293    1 MKLKALAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELINVDGLYRQHLTDKGAYVWKNLKDYY 80
gi 161508675   1 MKLKTLAKATLVLGLLATGVITTESQTVKAAESTQGQHNYKSLKYYYSKPSIELKNLDGLYRQKVTDKGVYVWKDRKDYF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21282116   81 IGLLGEDSKKFKSDVYGDLDAFLVIEEEPVKGRQYSIGGISKTNSKEFkEREVDVKVTRKADRDTTSTKDSKFKITKEEI 160
gi 88194186   81 VGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEF-SKEVDVKVTRKIDESSEKSKDSKFKITKEEI 159
gi 151220605  81 VGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEF-SKEVDVKVTRKIDESSEKSKDSKFKITKEEI 159
gi 87160396   81 VGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEF-SKEVDVKVTRKIDESSEKSKDSKFKITKEEI 159
gi 49485293   81 IGLLGEDSKKFKSDVYGDLDAFLVIEEEPVKGRQYSIGGISKTNSKEFkEREVDVKVTRKADRDTTSTKDSKFKITKEEI 160
gi 161508675  81 VGLLGKDIEKYPQGEHDKQDAFLVIEEETVNGRQYSIGGLSKTNSKEF-SKEVDVKVTRKIDESSEKSKDSKFKITKEEI 159
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 21282116  161 SLKELDFKLRQKLMKEENLYDAINHRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 232
gi 88194186  160 SLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 231
gi 151220605 160 SLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 231
gi 87160396  160 SLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 231
gi 49485293  161 SLKELDFKLRQKLMKEENLYDAINHRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 232
gi 161508675 160 SLKELDFKLRKKLMEEEKLYGAVNNRKGKIVVKMEDDKFYTFELTKKLQPHRMGDTIDGTKIKEINVELEYK 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap