Conserved Protein Domain Family
PRK13041

?
PRK13041: PRK13041 
superantigen-like protein SSL2; Reviewed
Statistics
?
PSSM-Id: 106078
View PSSM: PRK13041
Aligned: 15 rows
Threshold Bit Score: 443.307
Threshold Setting Gi: 87161928
Created: 9-Dec-2010
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49482651    1 MKMKSIAKVSLVLGILATGVNTVTEQPVHAENKHVQVSQNSKNLKAYYTQPSVEYKNVTGYISSIQpkPGTKFLNMIEGN 80
gi 49485289    1 MKMKSIVKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYTQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78
gi 87161928    1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78
gi 150392929   1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYTQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78
gi 15923413    1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYTQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78
gi 21282112    1 MKMKSIVKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYTQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78
gi 57651310    1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78
gi 88194181    1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78
gi 151220601   1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYNQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78
gi 156978751   1 MKMKNIAKISLLLGILATGVNTTTEKPVHAEKKPIVISENSKKLKAYYTQPSIEYKNVTGYISFIQ--PSIKFMNIIDGN 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49482651   81 TVNNLALVGKDKEHYHTGVHRNLDIFYVNEDKRFEGAKYSIGGITKASDKVVDQVAEARVIKEDHTGEYDYDFFPFKIDK 160
gi 49485289   79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIDK 158
gi 87161928   79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDK 158
gi 150392929  79 SVNNLALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIDK 158
gi 15923413   79 SVNNLALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIVK 158
gi 21282112   79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIDK 158
gi 57651310   79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDK 158
gi 88194181   79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDK 158
gi 151220601  79 SVNNIALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKEDHTGEYDYDFFPFKIDK 158
gi 156978751  79 SVNNLALIGKDKQHYHTGVHRNLNIFYVNEDKRFEGAKYSIGGITSANDKAVDLIAEARVIKADHIGEYDYDFFPFKIVK 158
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 49482651  161 EAMTLKEVDFKIRKHLIDHYGLYGEMSSGTVTVQMKYYGKYTIELDKKLQEDRMADIVKVIDIDRIEVKVKKA 233
gi 49485289  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVRKA 231
gi 87161928  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA 231
gi 150392929 159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVRKA 231
gi 15923413  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVRKA 231
gi 21282112  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVRKA 231
gi 57651310  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA 231
gi 88194181  159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA 231
gi 151220601 159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVIKA 231
gi 156978751 159 EAMSLKEIDFKLRKYLIDNYGLYGEMSTGKITVKKKYYGKYTFELDKKLQEDRMSDVINVTDIDRIEIKVRKA 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap