Conserved Protein Domain Family
PRK13190

?
PRK13190: PRK13190 
putative peroxiredoxin; Provisional
Statistics
?
PSSM-Id: 106159
View PSSM: PRK13190
Aligned: 5 rows
Threshold Bit Score: 377.271
Threshold Setting Gi: 15920801
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15920801    1 MVKLYSKFPDVQVLTTKGPIDFYKDifgKGKWLFLFAHPADFTPVCTTEFVAFSQKYEEFKKLGVELVGLSVDSIYSHIQ 80
gi 16082572    2 PVTLGQKAPDFTVNTSKGPVTLSSY---RGKWVLLFSHPGDFTPVCTTEFIAFTERYKDFQALGVELLGLSIDSVYSHIA 78
gi 13541930    2 PVVLGQKAPDFTVNTSKGPITLSNY---RGKWVLLFSHPGDFTPVCTTEFIAFTERYEDFQKLGVELIGLSIDSVFSHIA 78
gi 146304289   1 MVKTYQKFPDVQVMTTAGPIDFYKDvfgKGKWLFLFAHPADFTPVCTTEFAEFARNYSEFEKLGVQLVGLSVDSIYSHIA 80
gi 48477799    2 PVYLGKRAPDFTANTTRGVISLSDY---KNKWVLLFSHPADFTPICTTEFIEFSRRYNDFKELNVELIGLSVDSLQSHIE 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15920801   81 WLMDIEQRYGVKVPFPVIADPDKKLARMLDALDEASGQTIRIVVLASPDGIIRFVAQYPMEFGRNIDELLRITKAAIVNY 160
gi 16082572   79 WIRDIKEHFGIEIPFPIIADIDKEVARQYNLIDEKSGATVRGVFIIDPNQIVRWMIYYPAETGRNIDEIIRVIKALQFNW 158
gi 13541930   79 WIRDIKEHFGIDIPFPIIADIDKEVAREYNLIDEKSGATVRGVFIIDPNQIVRWMIYYPAETGRNIEEIIRVIKALQFNW 158
gi 146304289  81 WLTDIEQRYGLKIPFPVIADPEKKLARLLDLVEENSGLTVRGVFIVDPQGTIRFMAQYPIEAGRNIQELIRITKALIVSY 160
gi 48477799   79 WLKDIYEKFGIEIQFPVIADINKEIAREYNLIDENAGNTVRGVFIIDPNQTVRWMIYYPAETGRNIDEILRSVKALQANW 158
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*
gi 15920801  161 KAKVVLPANWQPGQDVIVPPPAIFDEAEMRIKLPNAKAWYLLFKK 205
gi 16082572  159 ERKLATPANWQPGQEGIEGAPSTVDASLKRDGEPGVKTWYLKFVK 203
gi 13541930  159 DRKLATPANWQPGQEGIEPAPTTVDSSFKRDNEQGVKTWYLKFVK 203
gi 146304289 161 KAKVSTPVNWEPGKEVVVGAPTTLMEAEMRMKLPNAKAWYLMFKK 205
gi 48477799  159 SRKIATPVNWRPGDKGILPPPSTLEDALQRIRE-GNKTWYIKTE- 201
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap