Conserved Protein Domain Family
PRK13225

?
PRK13225: PRK13225 
phosphoglycolate phosphatase; Provisional
Statistics
?
PSSM-Id: 106187
View PSSM: PRK13225
Aligned: 2 rows
Threshold Bit Score: 552.396
Threshold Setting Gi: 56751506
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56751506   1 MWKRSWKAFIARLSAIDPCGKAVEKLRGFSTGGIKGGSFLHRLKGFSTRNPQVFPQSYPQTLQAIIFDFDGTLVDSLPTV 80
gi 81301422   1 MWKRSWKAFIARLSAIDPCGKAVEKLRGFSTGGIKGGSFLHRLKGFSTRNPQVFPQSYPQTLQAIIFDFDGTLVDSLPTV 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56751506  81 VAIANAHAPDFGYDPIDERDYAQLRQWSSRTIVRRAGLSPWQQARLLQRVQRQLGDCLPALQLFPGVADLLAQLRSRSLC 160
gi 81301422  81 VAIANAHAPDFGYDPIDERDYAQLRQWSSRTIVRRAGLSPWQQARLLQRVQRQLGDCLPALQLFPGVADLLAQLRSRSLC 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56751506 161 LGILSSNSRQNIEAFLQRQGLRSLFSVVQAGTPILSKRRALSQLVAREGWQPAAVMYVGDETRDVEAARQVGLIAVAVTW 240
gi 81301422 161 LGILSSNSRQNIEAFLQRQGLRSLFSVVQAGTPILSKRRALSQLVAREGWQPAAVMYVGDETRDVEAARQVGLIAVAVTW 240
                       250       260       270
                ....*....|....*....|....*....|...
gi 56751506 241 GFNDRQSLVAACPDWLLETPSDLLQAVTQLMRQ 273
gi 81301422 241 GFNDRQSLVAACPDWLLETPSDLLQAVTQLMRQ 273
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap