Conserved Protein Domain Family
nifH

?
PRK13232: nifH 
nitrogenase reductase; Reviewed
Statistics
?
PSSM-Id: 106194
View PSSM: PRK13232
Aligned: 3 rows
Threshold Bit Score: 507.999
Threshold Setting Gi: 21226821
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667721   1 MRQIAIYGKGGIGKSTTTQNLTASLSTMGNKIMLVGCDPKADSTRMLLGGLNQKTVLDTLRSEGDEGVDLDVVMQRGFGD 80
gi 21226821   1 MRQIAIYGKGGIGKSTTTQNLTAALATMGNKILLVGCDPKADSTRMLLGGLNQKTVLDTLRSEGDEGVNLDVVVQPGFGN 80
gi 20092691   1 MRQIAIYGKGGIGKSTTTQNLTAALSTMGNNILLVGCDPKADSTRMLLGGLNQKTVLDTLRSEGDEGIDLDTVLQPGFGG 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667721  81 IKCVESGGPEPGVGCAGRGIITSIGLLENLGAYTDDLDYVFYDVLGDVVCGGFAMPIREGKAKEIYIVASGELMAIYAAN 160
gi 21226821  81 IKCVESGGPEPGVGCAGRGIITSIGLLENLGAYTEDLDYVFYDVLGDVVCGGFAMPIREGKAKEIYIVASGELMAIYAAN 160
gi 20092691  81 IKCVESGGPEPGVGCAGRGIITSIGLLENLGAYTDDLDYVFYDVLGDVVCGGFAMPIREGKAKEIYIVASGELMAIYAAN 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73667721 161 NICKGLAKFAKGGARLGGIICNSRNVDGERELLDAFAKKLGSQLIHFIPRDNIVQRAEINRKTVIDFDPESNQAKEYLTL 240
gi 21226821 161 NICKGLAKFAKGGARLGGIICNSRNVDGERELLEAFAKKLGSQLIHFVPRDNIVQRAEINRKTVIDFDPESNQAKEYLTL 240
gi 20092691 161 NICKGLAKFAKGGARLGGIICNSRKVDGERELLEAFAKKLGSHLIHFVPRDNIVQRAEINRKTVIDFDRESDQAKEYLTL 240
                       250       260       270
                ....*....|....*....|....*....|...
gi 73667721 241 AHNVQNNDKLVVPTPLPMEELESMMVEFGIVDM 273
gi 21226821 241 ASNVQNNTKLVVPTPLPMEELEAMMVEFGIVEL 273
gi 20092691 241 ADNVQNNNKLVVPTPLPMEELEAMMVEFGIVEL 273
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap