Conserved Protein Domain Family
ureA

?
PRK13242: ureA 
urease subunit gamma; Provisional
Statistics
?
PSSM-Id: 139420
View PSSM: PRK13242
Aligned: 10 rows
Threshold Bit Score: 177.961
Threshold Setting Gi: 161619301
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82700175    1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80
gi 189024485   1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80
gi 148559171   1 MRLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80
gi 23502228    1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80
gi 62290252    1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80
gi 161619301   1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGACEGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80
gi 256369772   1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80
gi 17986932    1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80
gi 225852839   1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80
gi 163843614   1 MHLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI 80
                         90       100
                 ....*....|....*....|
gi 82700175   81 QVEAVFSDGSRLVSLHNPIT 100
gi 189024485  81 QVEAVFSDGSRLVSLHNPIT 100
gi 148559171  81 QVEAVFSDGSRLVSLHNPIT 100
gi 23502228   81 QVEAVFSDGSRLVSLHNPIT 100
gi 62290252   81 QVEAVFSDGSRLVSLHNPIT 100
gi 161619301  81 QVEAVFSDGSRLVSLHNPIT 100
gi 256369772  81 QVEAVFSDGSRLVSLHNPIT 100
gi 17986932   81 QVEAVFSDGSRLVSLHNPIT 100
gi 225852839  81 QVEAVFSDGSRLVSLHNPIT 100
gi 163843614  81 QVEAVFSDGSRLVSLHNPIT 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap