Conserved Protein Domain Family
PRK13246

?
PRK13246: PRK13246 
dihydrobiliverdin:ferredoxin oxidoreductase; Provisional
Statistics
?
PSSM-Id: 106208
View PSSM: PRK13246
Aligned: 6 rows
Threshold Bit Score: 420.118
Threshold Setting Gi: 123967013
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78780070    1 MFDSLVDFLKTNIDELNGHELQISNEFKEHHNKDSKYIIKNWLFSSPEYRKWRITRLDGGKNIQVFNTVAYPNFDSELPI 80
gi 157414199   1 MFDSLVDFLKTNIDELNGHEVRISSEFKEHHNEDSKYIIKNWLFSSPEYRKWRITRLDGGKKLQVFNTVAYPNFDCEMPI 80
gi 123969334   1 MFDSLVDFLKTNIDQLNGHEVQISSEFKEHHNEDSKYIIKNWLFSSPEYRKWRITRLDGGKKLQVFNTVAYPNFESELPI 80
gi 123967013   1 MFDSLKNFLKKSIEDLDGKELEISKEFQEYHNKDSKYIIKNWLFESPQYRKWRVTKLDGGDKLQVFNTVAYPNFKSESPI 80
gi 126697123   1 MFDSLVDFLKTNIDELNGHEVQISGEFKEHHNEDSKYIIKNWLFSSSEYRKWRITRLDGGKKLQVFNTVAYPNFNSEMPI 80
gi 33862149    1 MFESLKNFVKTNIEDLDGKELEISKEFKEHHNKDSKYIIKNWIFESQQYRKWRITKLDGGDKLQVFNTVAYPNFKSEFPI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78780070   81 LGADILWFGTAKKLLAILDYQPLIQENKYLEKYCSSLGMIKKKYSAFDNNKMKNIYDSKKYFSPWVIICRGNKLNLDRDL 160
gi 157414199  81 LGADILWFGTSQKLLAILDYQPLIQEGKYLEKYCSSLGIIKKKYSAFDNNKMKNIYDSKKYFSPWVIICRGNKLNLDRDL 160
gi 123969334  81 LGADILWFGTSQKLLAILDYQPLIQESKYLEKYCSSLGIIKEEYSAFDNNKMKNIYDSKKYFSPWVIICRGNKLNLDRDL 160
gi 123967013  81 LGADILWFGTSQKLLAIFDYQPLIQEKKYLYQYCSSLDFIKKKYSVFDNNKMKNIYDSKKYFSPWVMICRGNKLNLDRDL 160
gi 126697123  81 LGADILWFGNSQKLLAILDYQPLIQENKYLEKYCSSLGSIKKKYSAFDNNKMKNIYDSKKYFSPWVIICRGNKLNLDRDL 160
gi 33862149   81 LGADILWFGTSQKLLAIFDYQPLIQEKKYLQKYCSSLDFIKNQYSVFDNHKMKNIYDSKKYFSPWVMICRGNKLNLDRDL 160
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 78780070  161 NDVFHAFINNYLNLNKSNPVNQFLNLEEIKINQIKYDKYSFEKDPADKLFKSFFGEKWTKKFINKFLFTLNNEIIL 236
gi 157414199 161 NNIFHSFVNNYLKIHKSNPVNQFLDTEKIKINQIKYDKYSFEKDPADKLFKSFFGEKWTKKFVNKFLFTLNNEIIY 236
gi 123969334 161 NDIFHSFVNNYLNIYKSNPVNQFLNSEEIKINQIKYDKYSFEKDPADKLFKSFFGEKWTKKFINKFLFTLNNEIIH 236
gi 123967013 161 NSIFYLFVSDYLRINKLNQNNQFLNYEQIKNKQIDYDKYSAEKDPADKLFKSFFGENWTCNFINNFLFTLNNYSKD 236
gi 126697123 161 NNIFHSFVKNYLNINKSNPVNQFLNAEEIKINQIKYDKYSFEKDPADKLFKSFFGEKWTKKFINKFLFTLNNEIIH 236
gi 33862149  161 NNIFCSFVSNYLTINKLHQNNQFLDLEQIKNNQIDYDKYSAEKDPADKLFKTFFGETWTENFINNFLFTLNHNPLK 236
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap