Conserved Protein Domain Family
PRK13249

?
PRK13249: PRK13249 
phycoerythrobilin:ferredoxin oxidoreductase; Provisional
Statistics
?
PSSM-Id: 139426
View PSSM: PRK13249
Aligned: 12 rows
Threshold Bit Score: 488.463
Threshold Setting Gi: 33241197
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148238817   2 SSLVRTSSLDPVQIKGWRWQPFLDKAISALETFRLSPYPIDETFLQREGSTGSKSKPVPVTTATWACATDKLRQVRCACV 81
gi 113954259   1 MTIQRLKSTDPVSIEGWSWQPFLEDAIKSLGGLNFEPYPVPDRFLQREDQTGSKSKPISVTTATWACKTEKFRQVRAACV 80
gi 33866553    2 SIDLRASSLDPVQIPGWRWQPFLDEASAALKPFNPSPYPIAETFLQKEGSTGSKAKPVPVTTATWACSTDKLRQVRCACV 81
gi 78211974    2 TLPLRTTSLDPVQIPGWRWQPFLDTAVAALSSLQPDPYPIAERFLQKEGSTGSKAKPVPVRTATWACSTEKLRQVRCACV 81
gi 148243161   1 MTTPRQSSLEPLSIANWRWQPFLDHACGALQPLELEPYPVAPEFLLQTSQTGSKSKPVQVTTATWACKTNKLRQVRAACV 80
gi 78185473    1 MTTTRHSSTDSVNIPGWGWQPFLEDAVQALQPLNLEPYPVANDFLYKQDQTGSKAKPITVTTATWACKTDKFRQVRAACV 80
gi 72383005    1 MQIIRNNSQDPISISNWRWACFLDETIKAFSTFQTRPYQIDNDFLFRESFFGSSSNPKKVILETWGLKMEKIRQARCACL 80
gi 124023937   1 MKPLRLSSLDPVRMPEWRWAPFLSHAINALIPLKPEPYPVAPEFLQREGKTGSKSQPIKVTTCTWACRTKKFRQVRAACV 80
gi 33863954    1 MKPSRLSSLDPVKMPEWRWAPFLSHAINAFIPLKPEPYPVAPEFLQREGKTGSKSQPIRVTTCTWACRTKKFRQVRAACV 80
gi 159904254   1 MKRERNNSLDPLEISEWRWSEFLDDAIKALELFDIEPYPIPEEFLTKEETIKFKNNQIKVKALTWACRTTKIRQARAACI 80
gi 124026747   1 MQIIRNNSQDPISISNWRWACFLDETIKAFSTFQTRPYQIDNDFLFRESFFGSSSNPKKVILETWGLKMEKIRQARCACL 80
gi 33241197    1 MIIKRDNSLSKIDLRDWIWTPFFNDLVDKLSVFEIEPYPVSHDFLSKESITGSRRNPVHVTTLTWAAKFEKIKQVRLACI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148238817  82 EAGTAASVLNFVINPSCRFDLPFFGADLVTLPNGHLLALDLQPVDKADPEHTGPVWERLMPVFERWQAELPDGGPIPEEA 161
gi 113954259  81 SAGSAASVLNFVINPNSTYDLPFFGGDLVTLPSGHLLALDLQPAIKTDEVHTTHVWDQLIPIFERWRDQLPYGGPIPEEA 160
gi 33866553   82 EAGMAASVLNFVINPSCRFDLPFFGADLVTLPNGHLLALDLQPVDKADPDHTQPVWERLMPLFERWQAELPDGGPIPEEA 161
gi 78211974   82 EAGAAASVLNFVINPSSRFDLPFFGADLVTLPNGHLLALDLQPVDKTDPDHTGPVWQRLMPLFERWRAQLPDGGPIPEEA 161
gi 148243161  81 EAGAAASVLNFVVNPSTSYDLPFFGADLVTLPAGHLLALDLQPALKTDAEHTKAVWERLMPIFERWQQRLPGGGPIPEEA 160
gi 78185473   81 YGGTAASVLNFVINPSARFDLPFFGGDLVTLPSGHLLALDLQPADKSDEAHTQQVWEKLIPIFERWRSKLPDGGPIPEEA 160
gi 72383005   81 QAGEITSVMNLVISPLNNYDLPFFGADFVTLPNGHLIALDLQPALKDDINHTQHVWNKLKPIHAHWQSKIPSGGDIPSDA 160
gi 124023937  81 EAGSSASVLNFVINPYHTFDLPFFGADLVTLPSGHLLALDLQPAITSDERHTKQVWERLMPIFEQWRVRLPEGGPIPEEA 160
gi 33863954   81 EAGRSASVLNFVINPYHTFDLPFFGADLVTLPSGHLLALDLQPAITSDERHTKQVWERLMPIFEHWRVHLPEGGPIPEEA 160
gi 159904254  81 EAGPAASVLNLVINPFHNFELPFFGADFVTLPSGHLLALDLQPVLKKDEIHNQKVWSKLIPIHDHWQSLLPSGGPIPQEA 160
gi 124026747  81 QAGEITSVMNLVISPLNNYDLPFFGADFVTLPNGHLIALDLQPALKDDINHTQHVWNKLKPIHAHWQSKIPTGGDIPSDA 160
gi 33241197   81 KGGESLSVFNLLIHPLNDYDLPFFGADFVTLPNGHLLALDLQPALKLDNIHTENVWPRLIPLHDHWQSLLPSGGEIPKEA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148238817 162 QPYFSPAFLWTRIPLGEEGDALIERVIRPAFIEYLQLYLKLVAEAQPVNDDRAASLLAGQKRYTAYRAEKDPARGMLTRF 241
gi 113954259 161 QPFFSPGFLWTRLPLGEEGDDLIQSVVRPAFNEYLELYLQLAASAERVNAERSDFLLQGQRKYTDYRAEKDPARGMLTRF 240
gi 33866553  162 QPYFSPAFLWTRIPLGEEGDELIERVIRPAFIDYLQLYLNLVAEAEPVSDDRAELLLSGQKRYTAYRAEKDPARGMLTRF 241
gi 78211974  162 QPYFSPAFLWTRIPLGEEGDALIDRVIRPAFADYLQLYLALVEEAQPVDHERAAHLLLGQKRYTAYRAEKDPARGMLTRF 241
gi 148243161 161 KPYFSPGFLWTRIPLGSEGDALIEEAVKPAFRDYLELYLQLVHEAEEVSPERSAELLAGQKRYTSYRAEKDPARGMLTRF 240
gi 78185473  161 QPFFSPGFLWTRLPLGDEGDQLINSVVRPAFNDYLSLYLELAEAAKPVGDDRRDHLLKGQRRYTDYRAEKDPARGMLTRF 240
gi 72383005  161 RQYFSPAFLWSRIPLGEEGDNLITQTIKPAFDEYLNCFFDLLRDAKITSKERSFQLLNGQKKYMRYRAEKDPARGMLRSF 240
gi 124023937 161 KPYFSPGFLWTRLHLGSEGNQLIDEVIMPAFRDYLNLYLDLVEMAEEVSPQRAFKLLEGQKRYLSYRGKKDPARAMLARF 240
gi 33863954  161 KPYFSPGFLWTRLPLSIEGNQLIDEVIMPAFKDYLNLYLDLVEMAEEVSPQRAFKLLEGQKRYLSYRAKKDPARAMLARF 240
gi 159904254 161 ETFFSPGFLWTRLPLDDQGSKLISKVIRPAFQEYLTLYIDLISDAQEVSKERSLEILSGQKAYINYRAEKDPARGMLARF 240
gi 124026747 161 RQYFSPAFLWSRIPLGEEGDNLITQTIKPAFDEYLNCFFDLLRDAKITSKERSFQLLNGQKKYMRYRAEKDPARGMLRSF 240
gi 33241197  161 EPYFSPGFLWSRLPLSKESDNIISEILRPAFGEYLSLYIELLHIAKPLKKERALKILEGQKAYINYRSTKDPARAMLCRF 240
                        250
                 ....*....|....*..
gi 148238817 242 YGSEWTESYIHDVLFDL 258
gi 113954259 241 HGSEWTEAYIHTVLFDL 257
gi 33866553  242 YGSEWTESYIHGVLFDL 258
gi 78211974  242 YGSEWTESYIHGVLFDL 258
gi 148243161 241 HGAEWTEAYIHGVLFDL 257
gi 78185473  241 HGSDWTEKYIHTVLFDL 257
gi 72383005  241 FGEVWTESYINNILFDL 257
gi 124023937 241 HGHQWTESYIHNVLFDL 257
gi 33863954  241 HGHQWTESYIHNVLFDL 257
gi 159904254 241 FGKDWTEQYIHKVLFDL 257
gi 124026747 241 FGEVWTESYINNILFDL 257
gi 33241197  241 YGKEWTEDYIHKVLFNI 257
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap