Conserved Protein Domain Family
PRK13296

?
PRK13296: PRK13296 
tRNA CCA-pyrophosphorylase; Provisional
Statistics
?
PSSM-Id: 106256
View PSSM: PRK13296
Aligned: 9 rows
Threshold Bit Score: 605.827
Threshold Setting Gi: 167627235
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118498171   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTANGYHGFEVNFSK 80
gi 167627235   1 MEFYLVGGAVRDILLGIAPKDRDWVVVGATETQMIKAGFTKILSSFPVFLHPETKEEYALARSEKKIAKGYHGFEVNFSS 80
gi 56707282    1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80
gi 110669752   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80
gi 134301319   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80
gi 89256942    1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80
gi 115315306   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80
gi 156503132   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80
gi 187931052   1 MKFYLVGGAVRDMLLGITPKDKDWVVVGATEDEMLANGFIKIAANFPVFIHPQTKQEYALARSEKKTASGYHGFEVNFSK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118498171  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAEETLTLI 160
gi 167627235  81 NITLEEDLKRRDLTINSMAIDKNNNIIDPFNGQNDIKNRILRHTSEAFIEDPLRVVRLARFKVQLSAFNFSIADETINII 160
gi 56707282   81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
gi 110669752  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
gi 134301319  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
gi 89256942   81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
gi 115315306  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
gi 156503132  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLSNFNFSIAQEMLALI 160
gi 187931052  81 YITLEDDLKRRDLTINSIAIDQNNKVIDPFNGQADLQNRILRHTSIAFIEDPLRVVRLARFKAQLCNFNFSIAQEMLALI 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118498171 161 KELIKTGELNHLTRERLHIEFVKALNNPKIFFTTLEELEALKIIFPNISCILLLIPNKSFFENPIYKDSNINEKITLCLL 240
gi 167627235 161 KSIIKSGELNYLTKERLHIEFIKALRNPKIFFETLDEFDSLRIIFPSIKKSLNAIPNNNFFRNKTYLNSSNEEKICLCLL 240
gi 56707282  161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCFLPLIPNKSFFENPIYKGSNINEKITLCLL 240
gi 110669752 161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCFLPLIPNKSFFENPIYKGSNINEKITLCLL 240
gi 134301319 161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNKSFFENPIYKGSNINEKITLCLL 240
gi 89256942  161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNKFFFENPIYKGSNINEKITLCLL 240
gi 115315306 161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNKFFFENPIYKGSNINEKITLCLL 240
gi 156503132 161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNKFFFENPIYKGSNINEKITLCLL 240
gi 187931052 161 KELVKTGELNHLTRERLHIEFVKALNNPKIFFTTLKELEALKIIFPNISCILPLIPNKSFFENPIYKGSNINEKITLCLL 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118498171 241 KVPQQKLDDIRKELLLTNKHYKLLKASIAISKILEDRNITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKVCDTITPH 320
gi 167627235 241 NLGDDTINNLKLELLLTNKQLKLLIATSAIKKIIEFKSINAETALKIIKRANLLRDKKLQQNAIDIFEKYSEIDNSRFSH 320
gi 56707282  241 KIPQQQLDDIRKEFLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
gi 110669752 241 KIPQQQLDDIRKEFLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
gi 134301319 241 KIPQQQLDDIRKELLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
gi 89256942  241 KIPQQQLDDIRKELLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
gi 115315306 241 KIPQQQLDDIRKELLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
gi 156503132 241 KIPQQQLDDIRKELLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
gi 187931052 241 KIPQQQLDDIRKELLLTNKHYKLLKASIAISKILEDRSITAEEIFQLIKNANIIRDKNLFAESLNLYKKYLKICDTITPH 320
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....*....
gi 118498171 321 RNYQLLQTTINTIKNASINSLtIETIPKDKLRNTLkqlyidiikKQLKL 369
gi 167627235 321 TIIKQFKSALNIINTTNIETL-ITTVPKENLANAIktlymdiikKQLNL 368
gi 56707282  321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
gi 110669752 321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
gi 134301319 321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
gi 89256942  321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
gi 115315306 321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
gi 156503132 321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
gi 187931052 321 RNYQLLQTTINTIKNASIDSLtIKTIPKDKLRNTL---------KQLKL 360
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap