Conserved Protein Domain Family
PRK13297

?
PRK13297: PRK13297 
tRNA CCA-pyrophosphorylase; Provisional
Statistics
?
PSSM-Id: 139469
View PSSM: PRK13297
Aligned: 5 rows
Threshold Bit Score: 611.615
Threshold Setting Gi: 187476684
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33599196    1 MSRADDPGVAGLQVYIVGGAVRDGLLGLPAGDRDWVVVGATPEDMARRGFIPVGGDFPVFLHPRTKEEYALARTERKSGR 80
gi 33594921    1 MSRTDDPGVAGLQVYIVGGAVRDGLLGLPAGDRDWVVVGATPEDMARRGFIPVGGDFPVFLHPRTKEEYALARTERKSGR 80
gi 33593986    1 MSRTDDPGVAGLRVYIVGGAVRDDLLGLPAGDRDWVVVGATPEDMARRGFIPVGGDFPVFLHPRTKEEYALARTERKSGR 80
gi 187476684   1 --MSADAAVAGLNAYIVGGAVRDALLGLPAGDRDWVVVGATPEEMARRGFIPVGGDFPVFLHPRTKEEYALARTERKSGR 78
gi 163859075   6 PTTAHDPDCDGLQVYIVGGAVRDALLGQPAGDRDWVVVGATPEDMARRGFIPVGGDFPVFLHPRTKEEYALARTERKSGR 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33599196   81 GYKGFTFYTGADVTLEQDLQRRDLTVNAIARTPQGELVDPLDGVADVRARVLRHVGEAFAEDPVRILRLGRFAARFGDFS 160
gi 33594921   81 GYKGFTFYTGADVTLEQDLQRRDLTVNAIARTPQGELVDPLDGVADVRARVLRHVGEAFAEDPVRILRLGRFAARFGDFS 160
gi 33593986   81 GYKGFTFYTGADVTLEQDLQRRDLTVNAIARTPQGELVDPLDGVADVRARVLRHVGEAFAEDPVRILRLGRFAARFGDFS 160
gi 187476684  79 GYKGFTFYTGSDVTLEQDLRRRDFTVNAIARAPGGELIDPLGGQADLRARCFRHVGEAFAEDPVRILRLGRFAARFTDFD 158
gi 163859075  86 GYKGFTFYTGADVTLEQDLLRRDLTVNAIARTPQGQLLDPLNGAADVRARVLRHVGEAFAEDPVRILRLGRFAARFGDFT 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33599196  161 IAPETMQLCRRMVEAGEADALVPERVWKEVSRGLMAQAPSRMLDVLARAGALARVMPELHDDAAVRAEIDRAAAAGLPLA 240
gi 33594921  161 IAPETMQLCRRMVEAGEADALVPERVWKEVSRGLMAQAPSRMLDVLARAGALARVMPELHDDAAVRAEIDRAAAAGLPLA 240
gi 33593986  161 IAPETMQLCRRMVEAGEADALVPERVWKEVSRGLMAQAPSRMLDVLARAGALARVMPELHDDTAVRAEIDRAAAAGLPLA 240
gi 187476684 159 IAPETLALCRQMVEQGEVDALVPERVWKELSRGLMETMPSRMLSVWARCGALARVMPQLRQWETVAPDLDEAARRGLALP 238
gi 163859075 166 VAPDTLALCRRMVENGEVDALVPERVWKELSRGLMAATPSRMLDVLAQSGALARVMPQLQDIDIVSADLDRAAAAGLPLP 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33599196  241 GRYALLCRHTPERDALGRRLRAPVECMDQARLLPLAVDALAASATPAAQLDLIERCDALRKPERFDALLQAAAIVAPVDL 320
gi 33594921  241 GRYALLCRHTPERDALGRRLRAPVECMDQARLLPLAVDALAASASTAAQLDLIERCDALRKPERFDALLQAAAIVAPVDL 320
gi 33593986  241 GRYALLCRHTPERDALGRRLRAPVECMDQARLLPLAVDALAASATPAAQLDLIERCDALRKPERFDALLQAAAIVAPVDL 320
gi 187476684 239 GRYALLSRLSTEPLA----LRVPADCADMARLLPEWLRALPA-PLPAQRLDLIERCDGLRKPERFMALAEAVAVVAEVDA 313
gi 163859075 246 GRYALLCRLAPERDALSRRLRVPTECADQARLLPRVVDQAGA-ADPPAQLALMESCDALRKPDRYAALLQAAAVVVAVDQ 324
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....
gi 33599196  321 SAWRARVQAVRAIDAGAIARQCAGDPARIKPALRQARLQALGGA 364
gi 33594921  321 SAWRARVQAVRAIDAGAIARQCAGDPARIKPALRQARLQALGGA 364
gi 33593986  321 SAWRARVQAVRAIDAGAIARQCAGDPARIKPALRQARLQALGGA 364
gi 187476684 314 QAWRRDLDAVRGVDAAAVARQCAGDPARIKPALRQVRLDTLV-- 355
gi 163859075 325 PAWQRRVDAVRGVDAGAIARQCAGDPARIKPALQQARLDALAAL 368
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap