Conserved Protein Domain Family
PRK13301

?
PRK13301: PRK13301 
putative L-aspartate dehydrogenase; Provisional
Statistics
?
PSSM-Id: 106261
View PSSM: PRK13301
Aligned: 3 rows
Threshold Bit Score: 437.616
Threshold Setting Gi: 33592964
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33600732   1 MTHRIAFIGLGAIASDVAAGLLADAAQPCQLAALTRNAADLPPALAGRVALLDGLPGLLAWRPDLVVEAAGQQAIAEHAE 80
gi 33596898   1 MTHRIAFIGLGAIASDVAAGLLADAAQPCQLAALTRNAADLPPALAGRVALLDGLPGLLAWRPDLVVEAAGQQAIAEHAE 80
gi 33592964   1 MTHRIAFIGLGAIASDVAAGLLADAAQPCQLAALTRNAADLPPALAGRVALLDGLPGLLAWRPDLVVEAAGQQAIAEHAE 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33600732  81 GCLRAGLDMIICSAGALADDALRARLIAAAEAGGARIRVPAGAIAGLDYLQAVAGRDDAEVVYESRKPVAAWRAELPGMG 160
gi 33596898  81 GCLKAGLDMIICSAGALADDALRARLIAAAEAGGARIRVPAGAIAGLDYLQAVAGRDDAEVVYESRKPVAAWRAELPGMG 160
gi 33592964  81 GCLTAGLDMIICSAGALADDALRARLIAAAEAGGARIRVPAGAIAGLDYLQAVAGRDDAEVVYESRKPVAAWRAELPGMG 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33600732 161 IDPDTLAESRTLFSGPAREAALRFPKNLNVAATLALAGIGMTRTRVEVVVDPRARGNQHRIQVRSPLGEMQIELVNAPSP 240
gi 33596898 161 IDPDTLAESRTLFSGPAREAALRFPKNLNVAATLALAGIGMTRTRVEVVVDPRARGNQHRIQVRSPLGEMQIELVNAPSP 240
gi 33592964 161 IDPDTLAESRTLFSGPAREAALRFPKNLNVAATLALAGIGMTRTRVEVVVDPQARGNQHRIQVRSPLGEMQIELVNAPSP 240
                       250       260
                ....*....|....*....|....*..
gi 33600732 241 ANPKTSWLVAQSVLATIRRHLARFTIG 267
gi 33596898 241 ANPKTSWLVAQSVLATIRRHLARFTIG 267
gi 33592964 241 ANPKTSWLVAHSVLATIRRHLARFTIG 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap