Conserved Protein Domain Family
PRK13324

?
PRK13324: PRK13324 
pantothenate kinase; Reviewed
Statistics
?
PSSM-Id: 106284
View PSSM: PRK13324
Aligned: 9 rows
Threshold Bit Score: 461.402
Threshold Setting Gi: 89256938
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118498167   1 MLLVMDVGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLSKIDGCGISSVVPHLNYSLGSAVIK 80
gi 167627239   1 MLLVMDVGNSHIHIGVFEGENIISQIRYATSSVDSTSDQIGVFLRQALRENSVDLSKIKGCAISSVVPHLNYSLGSAVIK 80
gi 56707286    1 MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIK 80
gi 110669756   1 MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIK 80
gi 134301323   1 MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIK 80
gi 89256938    1 MLLVMDMGNSHIHIGVFDGDIIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGYGISSVVPHLNYSLGSAVIK 80
gi 115315302   1 MLLVMDMGNSHIHIGVFDGDIIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGYGISSVVPHLNYSLGSAVIK 80
gi 156503128   1 MLLVMDMGNSHIHIGVFDGDIIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGYGISSVVPHLNYSLGSAVIK 80
gi 187931056   1 MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118498167  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
gi 167627239  81 YFGMKPFFISMETTDLDMTAVEAHQVGADRIASCIGAIADYPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
gi 56707286   81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
gi 110669756  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
gi 134301323  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
gi 89256938   81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
gi 115315302  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
gi 156503128  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
gi 187931056  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118498167 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATGGFAGLFKEEDIFDEISPD 240
gi 167627239 161 ALCQGASQLSSITIVKPEVAIGYDTKTNIRSGLYYGHLGALRELKTRSLKEFGAPVYTIATGGFAGLFKDEGIFDEISPD 240
gi 56707286  161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 240
gi 110669756 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 240
gi 134301323 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 240
gi 89256938  161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGAL----RRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 236
gi 115315302 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGAL----RRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 236
gi 156503128 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGAL----RRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 236
gi 187931056 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 240
                        250
                 ....*....|....*...
gi 118498167 241 LILRGIRIAFLENNKKGV 258
gi 167627239 241 LILRGIRIAFLENNKKGV 258
gi 56707286  241 LILRGIRIAFLENNKKGV 258
gi 110669756 241 LILRGIRIAFLENNKKGV 258
gi 134301323 241 LILRGIRIAFLENNKKGV 258
gi 89256938  237 LILRGIRIAFLENNKKGV 254
gi 115315302 237 LILRGIRIAFLENNKKGV 254
gi 156503128 237 LILRGIRIAFLENNKKGV 254
gi 187931056 241 LILRGIRIAFLENNKKGV 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap