Conserved Protein Domain Family
PRK13335

?
PRK13335: PRK13335 
superantigen-like protein SSL3; Reviewed
Statistics
?
PSSM-Id: 139494
View PSSM: PRK13335
Aligned: 15 rows
Threshold Bit Score: 579.774
Threshold Setting Gi: 82750138
Created: 9-Dec-2010
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 88194182    1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80
gi 82750138    1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAE--------KVPMLKAERLAMINITTGANTATTQAANTRQERTPKLEKAP 72
gi 57651311    1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80
gi 21282113    1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80
gi 49485290    1 MKMRTITKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80
gi 148266885   1 MNMKTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80
gi 150392930   1 MNMKTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80
gi 151220602   1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80
gi 269202046   1 MNMKTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80
gi 87161535    1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 88194182   81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
gi 82750138   73 NTNEEKTSASKIEKISQPKQEAQKSLNISATPAPKQEQSQTTTESTTPKTKVTTPPSINTPQPMQSTKSDTPQSPTIKQA 152
gi 57651311   81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
gi 21282113   81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTQQTKMTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
gi 49485290   81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTQQTKMTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
gi 148266885  81 NTNEEKTSASKIEKISQPKQEEQKSLNISAMPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
gi 150392930  81 NTNEEKTSASKIEKISQPKQEEQKSLNISAMPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
gi 151220602  81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
gi 269202046  81 NTNEEKTSASKIEKISQPKQEEQKSLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
gi 87161535   81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 88194182  161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
gi 82750138  153 QTDMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 232
gi 57651311  161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
gi 21282113  161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
gi 49485290  161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
gi 148266885 161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
gi 150392930 161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
gi 151220602 161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
gi 269202046 161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
gi 87161535  161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 88194182  241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
gi 82750138  233 LKKYSVGGITKTNSKKVDHKAELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVTKM 312
gi 57651311  241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
gi 21282113  241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
gi 49485290  241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
gi 148266885 241 LKKYSVGGITKTNSKKVDHKAELSVTKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
gi 150392930 241 LKKYSVGGITKTNSKKVDHKAELSVTKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
gi 151220602 241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
gi 269202046 241 LKKYSVGGITKTNSKKVDHKAELSVTKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
gi 87161535  241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
                        330       340       350
                 ....*....|....*....|....*....|....*.
gi 88194182  321 KNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK 356
gi 82750138  313 KNGGKYTFELHKKLQEHRMADVIEGTNIDKIEVNIK 348
gi 57651311  321 KNGGKYTFELHKKLQEHRMA----GTNIDNIEVNIK 352
gi 21282113  321 KNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK 356
gi 49485290  321 KNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK 356
gi 148266885 321 KNGGKYTFELHKKLQEHRMADVIEGTNIDKIEVNIK 356
gi 150392930 321 KNGGKYTFELHKKLQEHRMADVIEGTNIDKIEVNIK 356
gi 151220602 321 KNGGKYTFELHKKLQEHRMA----GTNIDNIEVNIK 352
gi 269202046 321 KNGGKYTFELHKKLQEHRMADVIEGTNIDKIEVNIK 356
gi 87161535  321 KNGGKYTFELHKKLQEHRMA----GTNIDNIEVNIK 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap