Conserved Protein Domain Family
PRK13345

?
PRK13345: PRK13345 
superantigen-like protein SSL9; Reviewed
Statistics
?
PSSM-Id: 106303
View PSSM: PRK13345
Aligned: 15 rows
Threshold Bit Score: 393.217
Threshold Setting Gi: 15923418
Created: 9-Dec-2010
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82750142    1 MKFTALAKATLALGILTTGVFTAESKAVHAKVELDETQCKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK 80
gi 88194189    1 MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK 80
gi 57651314    1 MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK 80
gi 15926106    1 MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINMLHQYYSEESFESTNISVKSEDYYGSNVLNFNQRNK 80
gi 148266890   1 MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINMLHQYYSEESFESTNISVKSEDYYGSNVLNFNQRNK 80
gi 150392935   1 MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINMLHQYYSEESFESTNISVKSEDYYGSNVLNFNQRNK 80
gi 156978757   1 MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINMLHQYYSEESFESTNISVKSEDYYGSNVLNFNQRNK 80
gi 151220608   1 MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK 80
gi 269202051   1 MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINMLHQYYSEESFESTNISVKSEDYYGSNVLNFNQRNK 80
gi 87161416    1 MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82750142   81 AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQK 160
gi 88194189   81 AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQK 160
gi 57651314   81 AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQK 160
gi 15926106   81 TFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQK 160
gi 148266890  81 TFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQK 160
gi 150392935  81 TFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQK 160
gi 156978757  81 TFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQK 160
gi 151220608  81 AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQK 160
gi 269202051  81 TFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQK 160
gi 87161416   81 AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQK 160
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 82750142  161 EEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKKIKNIEVNLN 232
gi 88194189  161 EEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN 232
gi 57651314  161 EEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN 232
gi 15926106  161 EEVSLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN 232
gi 148266890 161 EEVSLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN 232
gi 150392935 161 EEVSLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN 232
gi 156978757 161 EEVSLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN 232
gi 151220608 161 EEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN 232
gi 269202051 161 EEVSLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN 232
gi 87161416  161 EEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN 232
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap