Conserved Protein Domain Family
PRK13346

?
PRK13346: PRK13346 
superantigen-like protein SSL7; Reviewed
Statistics
?
PSSM-Id: 106304
View PSSM: PRK13346
Aligned: 14 rows
Threshold Bit Score: 417.484
Threshold Setting Gi: 15923416
Created: 9-Dec-2010
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82750140    1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQKGQ 80
gi 88194187    1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQ 80
gi 21282117    1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQ 80
gi 49485294    1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQ 80
gi 148266888   1 MKLKTLAKATLALGLLTTGVITSEGQAVHAKEKQERVQHLYDIKDLYRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQ 80
gi 150392933   1 MKLKTLAKATLALGLLTTGVITSEGQAVHAKEKQERVQHLYDIKDLYRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQ 80
gi 156978755   1 MKLKTLAKATLALGLLTTGVITSEGQAVHAKEKQERVQHLYDIKDLYRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQ 80
gi 151220606   1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQ 80
gi 269202049   1 MKLKTLAKATLALGLLTTGVITSEGQAVHAKEKQERVQHLYDIKDLYRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQ 80
gi 87162297    1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQ 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82750140   81 NHQLFLLGKDKEEYKEGIEGKDVFVVKELIDPNGRLSTVGGVTKKNNQSSETNTPLVVNKVYGGDLHASIDSFSINKEEV 160
gi 88194187   81 NHQLFLLGKDKEKYKEGIEGKDVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFSINKEEV 160
gi 21282117   81 NHQLFLSGKDKDKYKEGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNQSSETNTPLFIKKVYGGNLDASIESFLINKEEV 160
gi 49485294   81 NHQLFLSGKDKDKYKEGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNQSSETNTPLFIKKVYGGNLDASIESFLINKEEV 160
gi 148266888  81 NHQLFLLGKDKDKYKKGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFLINKEEV 160
gi 150392933  81 NHQLFLLGKDKDKYKKGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFLINKEEV 160
gi 156978755  81 NHQLFLLGKDKDKYKKGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFLINKEEV 160
gi 151220606  81 NHQLFLLGKDKEKYKEGIEGKDVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFSINKEEV 160
gi 269202049  81 NHQLFLLGKDKDKYKKGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFLINKEEV 160
gi 87162297   81 NHQLFLLGKDKEKYKEGIEGKDVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFSINKEEV 160
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 82750140  161 SLKELDFKIRKQLVEKYGLYQGTSKYGKITIILNDGKKEVIDLGDKLQFERMGDVLNSKDINKIEVTLKQI 231
gi 88194187  161 SLKELDFKIRQHLVKNYGLYKGTTKYGKITINLKDGEKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI 231
gi 21282117  161 SLKELDFKIRQHLVKNYGLYKGTTKYGKITFNLKDGEKQEIDLGDKLQFEHMGDVLNSKDIQNIAVTINQI 231
gi 49485294  161 SLKELDFKIRQHLVKNYGLYKGTTKYGKITFNLKDGEKQEIDLGDKLQFEHMGDVLNSKDIQNIAVTINQI 231
gi 148266888 161 SLKELDFKIRKQLVEKYGLYKGTTKYGKITINLKDEKKEVIDLGDKLQFERMGDVLNSKDIQNIAVTINQI 231
gi 150392933 161 SLKELDFKIRKQLVEKYGLYKGTTKYGKITINLKDEKKEVIDLGDKLQFERMGDVLNSKDIQNIAVTINQI 231
gi 156978755 161 SLKELDFKIRKQLVEKYGLYKGTTKYGKITINLKDEKKEVIDLGDKLQFERMGDVLNSKDIQNIAVTINQI 231
gi 151220606 161 SLKELDFKIRQHLVKNYGLYKGTTKYGKITINLKDGEKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI 231
gi 269202049 161 SLKELDFKIRKQLVEKYGLYKGTTKYGKITINLKDEKKEVIDLGDKLQFERMGDVLNSKDIQNIAVTINQI 231
gi 87162297  161 SLKELDFKIRQHLVKNYGLYKGTTKYGKITINLKDGEKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap