Conserved Protein Domain Family
PRK13349

?
PRK13349: PRK13349 
superantigen-like protein SSL13; Reviewed
Statistics
?
PSSM-Id: 106307
View PSSM: PRK13349
Aligned: 15 rows
Threshold Bit Score: 421.007
Threshold Setting Gi: 82750774
Created: 9-Dec-2010
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82750774    1 MNNNITKKIILSTTLLLLGTASTQFPNTPISSSTEAKAYYINQNETNVNELTKYYSQQHLTFSNKTLWQKDNGTIHATLL 80
gi 15924157    1 MNNNITKKIILSTTLLLLGTAFTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYLTFSNSTLWQKDNGTIHATSL 80
gi 15926750    1 MNNNITKKIILSTTLLLLGTAFTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYLTFSNSTLWQKDNGTIHATLL 80
gi 49486005    1 MNNNITKKIILSTTLLLLGTASTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYLTFSNSTLWQKDNGTIHATLL 80
gi 148267658   1 MNNNITKKIILSTTLLLLGTAFTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYLTFSNSTLWQKDNGTIHATLL 80
gi 150393716   1 MNNNITKKIILSTTLLLLGTAFTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYLTFSNSTLWQKDNGTIHATLL 80
gi 156979488   1 MNNNITKKIILSTTLLLLGTAFTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYLTFSNSTLWQKDNGTIHATLL 80
gi 151221288   1 MNNNITKKIILSTTLLLLGTASTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYLTFSNSTLWQKDNGTIHATLL 80
gi 269202780   1 MNNNITKKIILSTTLLLLGTAFTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYLTFSNSTLWQKDNGTIHATLL 80
gi 87161939    1 MNNNITKKIILSTTLLLLGTASTQFPNTPINSSSEAKAYYINQNETNVNELTKYYSQKYLTFSNSTLWQKDNGTIHATLL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82750774   81 QFSWYSHIQVYGPESWGNIIQLRNKNVDIFGIKDQETIDSFALSQETFTGGVTPAATSNDKHYKLNVTYKDQAETFTGGF 160
gi 15924157   81 QFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDSFALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGF 160
gi 15926750   81 QFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDSFALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGF 160
gi 49486005   81 QFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDSFALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGF 160
gi 148267658  81 QFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDSFALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGF 160
gi 150393716  81 QFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDSFALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGF 160
gi 156979488  81 QFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDSFALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGF 160
gi 151221288  81 QFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDSFALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGF 160
gi 269202780  81 QFSWYSHIQVYGPESWGNINQLRNKSIDIFGIKDQETIDSFALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGF 160
gi 87161939   81 QFSWYSHIQVYGPESWGNINQLRNKSVDIFGIKDQETIDSFALSQETFTGGVTPAATSNDKHYKLNVTYKDKAETFTGGF 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 82750774  161 PVYEGNKPVLTLKELDFRIRQTLIKSKKLYNNSYNKGQIKITGADNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS 240
gi 15924157  161 PVYEGNKPVLTLKELDFRIRQTLIKSKKLYNNSYNKGQIKITGTDNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS 240
gi 15926750  161 PVYEGNKPVLTLKELDFRIRQTLIKSKKLYNNSYNKGQIKITGTDNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS 240
gi 49486005  161 PVYEGNKPVLTLKELDFRIRQTLIKSKKLYNNSYNKGQIKITGADNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS 240
gi 148267658 161 PVYEGNKPVLTLKELDFRIRQTLIKSKKLYNNSYNKGQIKITGTDNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS 240
gi 150393716 161 PVYEGNKPVLTLKELDFRIRQTLIKSKKLYNNSYNKGQIKITGTDNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS 240
gi 156979488 161 PVYEGNKPVLTLKELDFRIRQTLIKSKKLYNNSYNKGQIKITGTDNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS 240
gi 151221288 161 PVYEGNKPVLTLKELDFRIRQTLIKSKKLYNNSYNKGQIKITGADNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS 240
gi 269202780 161 PVYEGNKPVLTLKELDFRIRQTLIKSKKLYNNSYNKGQIKITGTDNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS 240
gi 87161939  161 PVYEGNKPVLTLKELDFRIRQTLIKSKKLYNNSYNKGQIKITGADNNYTIDLSKRLPSTDANRYVKKPQNAKIEVILEKS 240

                 .
gi 82750774  241 N 241
gi 15924157  241 N 241
gi 15926750  241 N 241
gi 49486005  241 N 241
gi 148267658 241 N 241
gi 150393716 241 N 241
gi 156979488 241 N 241
gi 151221288 241 N 241
gi 269202780 241 N 241
gi 87161939  241 N 241
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap