Conserved Protein Domain Family
pcmA

?
PRK13372: pcmA 
protocatechuate 4,5-dioxygenase; Provisional
Statistics
?
PSSM-Id: 106330
View PSSM: PRK13372
Aligned: 2 rows
Threshold Bit Score: 926.738
Threshold Setting Gi: 116662337
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121607173   1 MSLDKPYLDVPGTIIFDAEQSRKGYWLNQFCMSLMQADNRARFKADERAYLDRWALTEAQKQAVLARDLNQCLRLGGNIY 80
gi 116662337   1 MTLDKPYKDVPGTTIFDADQARKGYNLNQFCMSLMKPENRERYLADRGAYLDEWPLNPVQRQAVLDIDLNTCIAEGGNIY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121607173  81 FLAKIGATDGKSFQQMAGSMTGLSEEQYRDMMISGGRPANGLRVPGENGATRTQPAPPAQpTGARPAKARISAAVFSSHV 160
gi 116662337  81 FLAKIGATHGLSFQQMAGSMTGMSEAAYRDMMIGGGRRPEGNRLKDLDGWTPPEPGEKAE-TVRQDAPAQYTSALFTSHV 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121607173 161 PAIGAAIDQGKTQQDYWKPLFAGYDLSRQWLREHRPDVILLVYNDHATAFSLEMIPTFAIGTAAQFQPADEGWGPRPVPP 240
gi 116662337 160 PAIGAAMDLGKTEEPYWKKVFSGYEWTREWAKENLPDVVILVYNDHATAFDSSIIPTFVLGTGAEYPVADEGYGPRPVPD 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121607173 241 VIGHPELAAHIAQSVIQQDFDLTIVNKMDVDHGLTVPLSLMCGQPLAWPCPVIPFAVNVVQYPVPSGRRCYQLGQAIRRA 320
gi 116662337 240 VKGYPELAAHIAQSVIQDDFDLTLVNEMVVDHGLTVPLSLVYGDVEEWPVRVIPLAVNVVQYPVPSGRRCYELGRALRRA 319
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121607173 321 IESYDAD-LNVQIWGTGGMSHQLQGPRAGLINKEFDNAFLDQLITDPEAAASIPHIDYVREAGSEGIELVMWLIARGAMS 399
gi 116662337 320 LDKWDGEpLNVQIWGTGGMSHQLQGPRAGLINEEWDNAFLDHLIADPVGLTEWQHMEYVDEAGSEGIELVDWLIARGAMD 399
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....
gi 121607173 400 DVARGATPDaaadgatgrppkVVHRFYHVPASNTAVGHLILENP 443
gi 116662337 400 DQFGGESPE------------VNHRFYHVPASNTAVGHLVLTNP 431
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap