Conserved Protein Domain Family
PRK13373

?
PRK13373: PRK13373 
putative dioxygenase; Provisional
Statistics
?
PSSM-Id: 106331
View PSSM: PRK13373
Aligned: 2 rows
Threshold Bit Score: 684.905
Threshold Setting Gi: 33603105
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603105   1 MAKIVAGIGMSHAPGALGWPDAPSASVRRRLLQAADRLGRSLDAARPDVIIAFLDDHFENHFRSLMPTVGIGVADSHPGP 80
gi 33598209   1 MAKIVAGIGMSHAPGALGWQDAPSASVRRRLLQAADRLGRSLDAARPDVIIAFLDDHFENHFRSLMPTVGIGVADSHPGP 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603105  81 ATQWLEALRLTRQERFGGAPEIAERLLRSLVADGYDVARMGEIEYGNNLMVPWKLMAPRSAPAIIPVFTNVFSPPVMPYR 160
gi 33598209  81 ATQWLEALRLTRQERFGGAPEIAERLLRSLVADGYDVARMGEIEYGNNLMVPWKLMAPRSAPAIIPVFTNVFSPPVMPYR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603105 161 RAYAFGAALRNAAEALDADLRVAFMATGGMSHWPPFWNDSSPEADAFLARMKAFQTHGKSVLEKDPHLLRDLAAYEIEMA 240
gi 33598209 161 RAYAFGAALRNAAEALDADLRVAFMATGGMSHWPPFWNDSSPEADAFLARMKAFQTHGKSVLEKDPHLLRDLAAYEIEMA 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33603105 241 ERNQWPLNSPHPLVNEAWDRQMLDALARGDVEFLCGLQYEDVKRDGGHGGQEIINWIELMGAMKGAPATLLEYEAVTEWI 320
gi 33598209 241 ERNQWPLNSPHPLVNEAWDRQMLDALARGDVEFLCGLQYEDVKRDGGHRGQEIINWIELMGAMKGAPATLLEYEAVTEWI 320
                       330       340
                ....*....|....*....|....
gi 33603105 321 CGMAYMDYGVAQAWPVNPLIKEQE 344
gi 33598209 321 CGMAYMDYGVAQAWPVNPLIKEQE 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap