Conserved Protein Domain Family
PRK13378

?
PRK13378: PRK13378 
protocatechuate 4,5-dioxygenase subunit alpha; Provisional
Statistics
?
PSSM-Id: 139527
View PSSM: PRK13378
Aligned: 14 rows
Threshold Bit Score: 180.702
Threshold Setting Gi: 192289608
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171060368   4 PLRESGHIDIPGTIIFDGAQAMKGYALNKMCFSFNDAANRTAFLADEDGYCARYGLNGQQREAIRNRNVLQLLAAGGNAY 83
gi 39934081   16 AGAGRAKREIFGTPIFGPESAQKGYALNKMCFSFNDAGARAAFVKDEAAYCARYGLTAAQTEAILKRDLLKLLDEGGNAY 95
gi 86748185   10 EAGAYLKRDIFGTPIFGPEAAQKGYALNKMCFSFNSAAARADFVADEAAYCARYGLTATQTEAILKRDLLKLLDHGGNAY 89
gi 192289608   7 AGAGRAKREIFGTPIFGPESAQKGYALNKMCFSFNDAGARAAFVKDEAAYCARYGLTAAQTEAILKRDLLKLLDEGGNAY 86
gi 119898814   1 -MATRQKREIPGTSIFDGELAQKGYALNKMCFSFNSADNRAEFQRDEAAYCRKFGLNDEQETAIRTRNVLGLLAAGGNVY 79
gi 83309356    1 -MAPKTKRVIPGTTLFDGDMARKGYALNKMCFSFNSEENRQEFLKDPGAYCDKFGLNEQQKKAVISLQVLDMLAAGGNAY 79
gi 113473781   1 --MTTEAQLIPGTTLFDGGAARKGYALNAMCFSFNEKVNRDAFLADEASYMDRYGLTPEQRESVVGRDILGMIAAGGNIY 78
gi 152997936   1 MASNYTDRKLQGTYLFDGQMAKKGYGLNKMCYSFNDQTARDEFNADPEAYCEKFKLTEAQKEAIRNRDVIGLLREGGSIY 80
gi 121605628   5 LPRISNLPKIPGTTQFDGEQARKGYALNKMCFSFNSADNRNAFKADEEAYMRQYGLNETQAAAIRARNVLQLIAAGGNAY 84
gi 160896364   1 ---MADQPQIPGTTLFDGRQARKGYALNSMCFSFNELANRQAFLADEEAYMRSYGLNQEQADAVRARNVLQMIAAGGNAY 77
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 171060368  84 YLAKFAGIFGLDMQDIGAQQTGMTKDEFKARLLAARG 120
gi 39934081   96 YLAKFAGILGLNMQDIGALQTGMTVEQFKAKLLAARD 132
gi 86748185   90 YLAKFAGILGLNMQDIGALQTGMSVEQFKAKLLAARD 126
gi 192289608  87 YLAKFAGILGLNMQDIGALQTGMTVEQFKAKLLAARD 123
gi 119898814  80 YLAKFAGILGLDVQDLGAAQTGMTKEAFKAMLVAAGK 116
gi 83309356   80 FIAKLGGIYKLDMQDVGAQQTGVTKEEFQAKLVAAGR 116
gi 113473781  79 YLAKLAGIFGLNVQDVGSMQTGVSVEKFKEMLLAQGR 115
gi 152997936  81 YLAKFTGLLKLNMQDIGGLQTGMSTDEFKAMLEKNGR 117
gi 121605628  85 YLAKFAGIFGLDMQDIGAQQTGLTKDEFKARLIAAGQ 121
gi 160896364  78 YLAKLAGIFHLDMQDIGAQQTGMTKAEFQALLRSHA- 113
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap