Conserved Protein Domain Family
PRK13383

?
PRK13383: PRK13383 
acyl-CoA synthetase; Provisional
Statistics
?
PSSM-Id: 139531
View PSSM: PRK13383
Aligned: 4 rows
Threshold Bit Score: 961.377
Threshold Setting Gi: 118619872
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118464228   1 MAPTAARALVRSGLLNPPSPRAVLRLLREASRGGTNPYTLLAVTAARWPGRTAIIDDDGALSYRELQRATESLARRLTRD 80
gi 41409595    6 VAPTAARALVRSGLLNPPSPRAVLRLLREASRGGTNPYTLLAVTAARWPGRTAIIDDDGALSYRELQRATESLARRLIRD 85
gi 183980327   6 VVTTAARALLGSGLLSPSSPAAALRLVRELYRGGTNLYTPLAIAAARWPERTAIVDDDGALSYREIQTMTESVAGELTLA 85
gi 118619872   6 VVTTAARALLGSGLLSPSSPAAALRLVRELYRGGTNLYTPLAIAAARWPERTAIVDDDGALSYREIQTMTESVAGELTLA 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118464228  81 GVAPGRAVGVMCRNGRGFVTAVFAVTLLGADVVPISTEFRSDALAAALRAHHISTVVADNEFAERIAAADDAVAVIDPAT 160
gi 41409595   86 GVAPGRAVGVMCRNGRGFVTAVFAVALLGADVVPISTEFRSDALAVALRAHHISTVVADNEFAERIAGADDAVAVIDPAT 165
gi 183980327  86 GIGPGQAVGVMCRNGRNFVAAAFAAGLVGADVVLVNTEFRATALAAALEAHQMRVMLCDDEFVDQVAGTGESVLVIDPST 165
gi 118619872  86 GIGPGQAVGVMCRNGRNFVAAAFAAGLVGADVVLVNTEFRATALAAALEAHQMRVMLCDDEFVDQVAGTGESVLVIDPST 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118464228 161 AGAEESGGRPAVAAPGRIVLLTSGTTGKPKGVPRAPQLRSAVGVWVTILDRTRLRTGSRISVAMPMFHGLGLGMLMLTIA 240
gi 41409595  166 AGAEESGGRPAVAAPGRIVLLTSGTTGKPKGVPRAPQLRSAVGVWVTILDRTRLRTGSRISVAMPMFHGLGLGMLMLTIA 245
gi 183980327 166 VTARDC-ARPKVAPSGRIVLLTSGTTGVPKGVPRKPKVSSGIGVSVTLLERTRLRVGSRMTLATPMFHGLGFGMLVLTIS 244
gi 118619872 166 VTARDC-ARPKVAPSGRIVLLTSGTTGVPKGVPRKPKVSSGIGVSATLLERTRLRVGSRMTLATPMFHGLGFGMLVLTIS 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118464228 241 LGGTVLTHRHFDAEAALAQASLHRADAFTAVPVVLARILELPPRVRARNPLPQLRVVMSSGDRLDPTLGQRFMDTYGDIL 320
gi 41409595  246 LGGTVLTHRHFDAEAALAQASLHRADAFTAVPVVLARILELPPRVRARNPLPQLRVVMSSGDRLDPTLGQRFMDTYGNIL 325
gi 183980327 245 LGGTVLTRRHFDAEATLAQTSLHRADGLSVVPIMLARILDLPDQVRARNPLPCLRVVISSGDRLDPSLARRFMEAYGDVL 324
gi 118619872 245 LGGTVLTRRHFDAEATLAQTSLHRADGLSVVPIMLARILDLPDQVRARNPLPCLRAVISSGDRLDPSLARRFMEAYGDVL 324
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118464228 321 YNGYGSTEVGIGALATPADLRDAPETVGKPVAGCPVRILDRNNRPVGPRVTGRIFVGGELAGTRYTDGGGKAVVDGMTST 400
gi 41409595  326 YNGYGSTEVGIGALATPADLRDAPETVGKPVAGCPVRILDRNNRPVGPRVTGRIFVGGELAGTRYTDGGGKTVVDGMTST 405
gi 183980327 325 YNLYGSTEVGIGALATPAELRDWPETVGRPVAGCPVRIFDRNGRPVGPRVTGRIFVGGELNSDGYSGGGGKAVIDGMAST 404
gi 118619872 325 YNLYGSTEVGIGALATPAELRDWPETVGRPVAGCPVRIFDRNGRPVGARVTGRIFVGGELNSDGYSGGGGKAVIDGMAST 404
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118464228 401 GDMGYLDNAGRLFIVGREDDMIISGGENVYPRAVENALAAHPAVADNAVIGVPDERFGHRLAAFVVLHPGSGVDAAQLRD 480
gi 41409595  406 GDMGYLDNAGRLFIVGREDDMIISGGENVYPRAVENALAAHPAVADNAVIGVPDERFGHRLAAFVVLHPGSGVDAAQLRD 485
gi 183980327 405 GDMGYLDESGRLYIVGREDDMIVSGGENVYPRSLENALASHPDVAENAVIGVADEQFGQRLAAFVVARPGCDIDADAIRD 484
gi 118619872 405 GDMGYLDESGRLYIVGREDDMIVSGGENVYPRSLENALASHPDVAENAVIGVADEQFGQRLAAFVVARPGCDIDADAIRD 484
                        490       500       510
                 ....*....|....*....|....*....|....*.
gi 118464228 481 YLKDRVSRFEQPRDINIVASIPRNPTGKVLRKELPG 516
gi 41409595  486 YLKDRVSRFEQPRDINIVSSIPRNPTGKVLRKELPG 521
gi 183980327 485 YLKGRVSRFEQPRDIHLVSSIPRNPAGKVLRKQLAS 520
gi 118619872 485 YLKGRVSRFEQPRDIYLVSSIPRNPAGKVLRKQLAS 520
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap