Conserved Protein Domain Family
PRK13403

?
PRK13403: PRK13403 
ketol-acid reductoisomerase; Provisional
Statistics
?
PSSM-Id: 106361
View PSSM: PRK13403
Aligned: 19 rows
Threshold Bit Score: 622.923
Threshold Setting Gi: 52143567
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163939692   1 MKTYYEKDANLELLKGKTVAVVGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVISVSEAVRTAQVVQMLLP 80
gi 42781005    1 MKTYYEKDANVELLKGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSFEVAKTDGFEVMSVSEAVRTAQVVQMLLP 80
gi 30019921    1 MKTYYEKDANVELLQGKTVAVVGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVMSVSEAVRTAQVVQMLLP 80
gi 52143567    1 MKTYYEKDANVDLLQGKTVAVVGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVMSVSEAVRTAQVVQMLLP 80
gi 222095513   1 MKTYYEKDANVDLLQGKTVAVVGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVMSVSEAVRTAQVVQMLLP 80
gi 218232349   1 MKTYYEKDANVELLQGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVMSVSEAVRTAQVVQMLLP 80
gi 217959374   1 MKTYYEQDANVELLKGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSFEVAKADGFEVMSVSEAVRTAQVVQMLLP 80
gi 218903007   1 MKTYYEQDANVGLLQGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSFEVAKADGFEVMSVSEAVRTAQVVQMLLP 80
gi 301053422   1 MKTYYEQDANVGLLQGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSFEVAKADGFEVMSVSEAVRTAQVVQMLLP 80
gi 296502481   1 MKTYYEKDANVELLQGKTVAVVGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVMSVSEAVRTAQVVQMLLP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163939692  81 DEQQAYVYKTEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
gi 42781005   81 DEQQAHVYKAGVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
gi 30019921   81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
gi 52143567   81 DEQQAHVYKAEIEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
gi 222095513  81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
gi 218232349  81 DEQQAHVYKSEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVYQEGNGVPALVAVHQDATGTAL 160
gi 217959374  81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
gi 218903007  81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
gi 301053422  81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
gi 296502481  81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163939692 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
gi 42781005  161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQTVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
gi 30019921  161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
gi 52143567  161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
gi 222095513 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
gi 218232349 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
gi 217959374 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
gi 218903007 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
gi 301053422 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
gi 296502481 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 163939692 241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLAEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
gi 42781005  241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
gi 30019921  241 GLTTMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
gi 52143567  241 GLTNMRHSISDTAEFGDYVTGSRIVTDGTKKEMKRVLTEIQQGEFAKKWILENQAGRPTHNAMKKAEQNHGLEKVGAELR 320
gi 222095513 241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
gi 218232349 241 GLTTMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
gi 217959374 241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
gi 218903007 241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGEELR 320
gi 301053422 241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGEELR 320
gi 296502481 241 GLTTMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
                        330
                 ....*....|....*..
gi 163939692 321 EMMSWIKEPekKTLVKK 337
gi 42781005  321 EMMSWIDAP--KELVKK 335
gi 30019921  321 EMMSWIHAP--KELVKK 335
gi 52143567  321 EMMSWIHAP--KELVKK 335
gi 222095513 321 EMMSWIHAP--KELVKK 335
gi 218232349 321 EMMSWIHAP--KELVKK 335
gi 217959374 321 EMMSWIHAP--KELVKK 335
gi 218903007 321 EMMSWIHAP--KELVKK 335
gi 301053422 321 EMMSWIHAP--KELVKK 335
gi 296502481 321 EMMSWIHAP--KELVKK 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap