Conserved Protein Domain Family
PRK13425

?
PRK13425: PRK13425 
F0F1 ATP synthase subunit gamma; Provisional
Statistics
?
PSSM-Id: 139564
View PSSM: PRK13425
Aligned: 11 rows
Threshold Bit Score: 539.399
Threshold Setting Gi: 193214590
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 193214590   1 MATLREIRTRIKSVKSTQQLTKAMKMVAAAKLRRAQDRALQARPYAAKLKELLDSLSGKVDTTINPLLTPRSEVKNVLVI 80
gi 189347804   1 MPTLKDIRVRIKGIKSTQQVTKAMKMVAAAKLRRAQERAIMARPYAGKLKEMLGSLSAKVDTSLNPLLSSRQDVKKVLVI 80
gi 145220430   1 MPTLKDIRVRIKGVTSTQQVTKAMKMVAAAKLRRAQERAVMARPYAAKLSEMLGSLSAKVDTSENPLLSGRSEVRGALVI 80
gi 119358311   1 MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQERAIMARPYARKLKEMLGSLSDKVDTSLNPLLSNRSEVNKVVVI 80
gi 189499278   1 MATLKDIRTRIQSIASTQQVTKAMKMVSAAKLRRAQDSAIQARPYAAKLKEMLGSLSTRVDTTLNPLLSDRDEVKNVLVV 80
gi 78188124    1 MATLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQDRAIMARPYASKLKEMLASLSAKVDTSVNPLFAVRSEVNKVLVI 80
gi 78187826    1 MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRKAQERAVMARPYAAKLKEMLGSLSGKVDTSASPLLADRADASRVLVV 80
gi 194337685   1 MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQERAVMARPYAKKLKEMLGSLSAKVDTSRNPMLSGRSEVNKVLVI 80
gi 194333107   1 MATLKDIRTRIKGVKSTQQVTKAMKMVAAAKLRRAQESAVQARPYAAKLKEMLGSLSTKVDTSLNPMLSARDEVGRVLVV 80
gi 193213547   1 MPTLKDIRIRLKGIKSTQQVTKAMKMVAAAKLRRAQDRAIQARPYAGKLKEMLASLSTKVDTSLNPLLSPREEVNKVLVV 80
gi 21674842    1 MPTLKDIRIRLKGVKSTQQVTKAMKMVAAAKLRRAQDRAIQARPYAGKLKEMLASLSTKVDTSVNPLLSPREEVNNVLVI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 193214590  81 LVTSDRGLCGAFNTNIIKMAQRLIDQDYADMSRQGRVKMICAGRRGNDFFRKRGYNVVYGYPNIFNQLDFNAAKEIVEKA 160
gi 189347804  81 LIAADRGLCGAFNTNIIKLAQKVVTEDYAAQYKNGGVSMICAGSRGFDFFRKRGFSIVKGYPSVFQNLDFSVAKEIAETA 160
gi 145220430  81 LITSDRGLCGGFNTNIIKVAQRVVNNEYGELNAAGRLSMICAGTRGFDFFRKRGYTILKGYPSVFQNLDFSTAQEIAETA 160
gi 119358311  81 LITADRGLCGAFNTNIVKLAYKLIHEDYAAQHSKNGVSLICAGSRGFDFFRKRGYNIIKGYPGVFQRLDFSFAKEIAETV 160
gi 189499278  81 VITSDRGLCGAFNANIIKIAQKVVTEEHGDLYRDGKVEMLCAGSKGNDYFRKRGFSISKAYPGLFQNLHFSVAREIAEYA 160
gi 78188124   81 LVTSDRGLCGAFNGNIIKLAYKTIHEDYAAQYGKGGVSMICAGTRGYEFFKKRHYTLTKGYPAVFQNLDFAVAKEIADMA 160
gi 78187826   81 LITSDRGLCGAFNTNIIKLAHRTIHEEYAAAYAAGNVQLICAGTRGFDFFRKRGYSVLKGYPAVFQNLDFSTAREIAETA 160
gi 194337685  81 LVTADRGLCGAFNTNAIKLASKIIHEDYPAIHSKGGVSLICAGSRGFDFFRKREYNIVKGYSAVFQHLDFSTAKEIADIA 160
gi 194333107  81 LITSDRGLCGAFNTNIIKVAQKVMTVDHADLHKSGKVDLICAGSKGYDFFRKRDYRILKGYPGVFQNLDFSVAKEIAEQA 160
gi 193213547  81 LVTSDRGLCGGFNANIMKLAQRVIHEDYAAQHAKGAVTMICAGTKGSDFFRKRGYNVTKAYPGVFQNLDFSSAKEIAELA 160
gi 21674842   81 LVTSDRGLCGGFNANIIKMAQRLIHEEYAALHAKGGVTMICAGTKGTEFFRKRGYKLAAAYPGVFQNLSFDSAREIADKA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 193214590 161 TELYLSGEVDKVHVIYNEFKNVVSPNLISEVFLPIAPSKKDDAGSDaarqnklvpivDYIYEPSPEAIINELVPKHLNTQ 240
gi 189347804 161 SGMYLRGEADKVIVVYNEFKSVLAPVLKAEDLLPIAAENAGKDNSG-----------DYIYEPSPAVIIDELVPKHLSTQ 229
gi 145220430 161 SSMYLKGEVDKVVVVYNEFKSVLAPVLKAETLLPISSEENEGDRGG-----------DYIYEPSPSAIISELVPKHLNTQ 229
gi 119358311 161 SGMYLRGEADRVVVVYNEFKSVLAPVLKFETLLPITPEASGKDGGS-----------DYIYEPSPESIIDVLVPKHLNTQ 229
gi 189499278 161 SERYLKGEVDKVVVVYNEFKSVLAPVLKSEVLLPITPEKVEGEKTGss--------iDYIYEPSPSAIIDVLVPKHLNTQ 232
gi 78188124  161 SNMYLRGEVDRVVVVYNEFKSVLAPQLKSEVLLPITSGDASAKENSg---------gEYMYEPNPAAIIDVLLPKHLRTQ 231
gi 78187826  161 SSMYVKGEVDRVVVVYNEFKSVLAPTLKAEVLLPIKSELPVAEGG------------DYIYEPSPAAIIEELVPKHLNTQ 228
gi 194337685 161 SGMYLRGEVDRVLVAYNEFKSVLAPNLREEVILPIAPEIPGTESSS-----------DYIYEPSPSAIIDELVPKHLNTQ 229
gi 194333107 161 SGMYLRGEVDKVVVVYNEFKSVLAPNLKSEVLLPITPEGSGDEGGS-----------DYIYEPSPASIIDVLVPKHLNTQ 229
gi 193213547 161 SQMYLKGEADKVILVYNEFKSVLAPNLRTEQLLPIAPEEGTEEAAGs----------EYLYEPSPEAIIDELVPKHLNTQ 230
gi 21674842  161 SKMYLSGEVDRVVLVYNEFKSVLAPNLRTEQLLPITPEGGDAKTASs----------EYLYEPSPAAIIDELVPKHLNTQ 230
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 193214590 241 LWRVLLESNAAEQASRMTAMDSATDNAKELLRSLSITYNRARQAAITKEILEIVGGANALEQ 302
gi 189347804 230 VWRMMLESNAAEQAARMTAMDSATENAKELLRTLNISYNRARQAAITKELSEIVAGADALKN 291
gi 145220430 230 VWRMMLESNAAEQAARMTAMDSATENAKELLRTLNISYNRARQAAITKELSEIVGGADALQN 291
gi 119358311 230 VWRVMLESNAAEQAARMSAMDSATENAKELLRTLNISYNRARQAAITKELSEIVGGADALKG 291
gi 189499278 233 IWRMMLESNAAEHASRMTAMDSATENAKELMRVLKISYNRARQAAITTELSEIVAGAEALQG 294
gi 78188124  232 VWRIMLESNAAEQAARMAAMDSATENAKELLRTLNISYNRARQAAITTELSEIVAGAEALNG 293
gi 78187826  229 VWGMMLESNAAEQAARMTAMDSATENAKELLRGLNISYNRARQAAITKELSEIVGGADALQN 290
gi 194337685 230 IWRMMLESSAAEQAARMSAMDSATENAKELMRTLNISYNRARQAAITTELSEIVSGADALTN 291
gi 194333107 230 VWRMMLESNAAEQAARMAAMDSATENAKELLRLLNISYNRARQAAITTELSEIVAGAEALQG 291
gi 193213547 231 VWRVMLESNAAEQAARMAAMDSATENAKELIRVLNISYNRARQAAITKELSEIVAGADALKQ 292
gi 21674842  231 LWRVMLESNAAEQAARMAAMDSATENAKELIRVLNISYNRARQAAITKELSEIVAGADALKQ 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap