Conserved Protein Domain Family
PRK13434

?
PRK13434: PRK13434 
F0F1 ATP synthase subunit delta; Provisional
Statistics
?
PSSM-Id: 139571
View PSSM: PRK13434
Aligned: 6 rows
Threshold Bit Score: 282.207
Threshold Setting Gi: 189910330
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910330   1 MSLNQISKVYATALLElaqEANSLESTEEELSSLVGVFFSDDTIRHYFLSPLVDPSEKEQTAAKSVQGKASEIVANFITL 80
gi 45657123    1 MNDSGVSKTYASALLG---ATNVPEEVEQELGDLAQLLFKDEKVKNFFLSPTVSNEEKEKVLIKNLRGKISDITLNFLGV 77
gi 24215480    1 MNDSGVSKTYASALLG---ATNVPEEVEQELGDLAQLLFKDEKVKNFFLSPTVSNEEKEKVLIKNLRGKISDITLNFLGV 77
gi 183220212   1 MSLNQISKVYATALLElaqEANSLESTEEELSSLVGVFFSDDTIRHYFLSPLVDPSEKEQTAAKSVQGKASEIVANFITL 80
gi 116328616   1 MNDSGVSKIYASALLG---AVNSPEEVEQELGDLVQLLFKEEKIRNFFLSPTVSIEEKENILEKNLRGKILDVTLNFLGV 77
gi 116331345   1 MNDSGVSKIYASALLG---AVNSPEEVEQELGDLVQLLFKEEKIRNFFLSPTVSIEEKENILEKNLRGKILDVTLNFLGV 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910330  81 VVRKNRFLYLKDILEDYRSGVDRLKNRSSLRIVSKDSLGKEAVDQITKSISSKFGREVRVTEHTDLNLIGGFKIYIDDFL 160
gi 45657123   78 LLNRGRIIHLPEIQKQFTVELDKKKGRVRAQVRSYPSLEPAQAAKLGSILSEKFKSEFILEVSEDKSLLGGFVVQFNDLK 157
gi 24215480   78 LLNRGRIIHLPEIQKQFTVELDKKKGRVRAQVRSYPSLEPAQAAKLGSILSEKFKSEFILEVSEDKSLLGGFVVQFNDLK 157
gi 183220212  81 VVRKNRFLYLKDILEDYRSGVDRLKNRSSLRIVSKDSLGKEAVDQITKSISSKFGREVRVTEHTDLNLIGGFKIYIDDFL 160
gi 116328616  78 LLNKGRFINLPEIQKRFTVELDKKKGRVRAQIKSYPSLEPAQITKLGSILSEKFKSEFILEVSEDKTLLGGFVVQFNDLK 157
gi 116331345  78 LLNKGRFINLPEIQKRFTVELDKKKGRVRAQIKSYPSLEPAQITKLGSILSEKFKSEFILEVSEDKTLLGGFVVQFNDLK 157
                        170       180
                 ....*....|....*....|....*..
gi 189910330 161 IDASIRAKLAGTREALLQKKIPVGAFE 187
gi 45657123  158 IEKSIASQLGEIKKSMLEKKLPVGAIY 184
gi 24215480  158 IEKSIASQLGEIKKSMLEKKLPVGAIY 184
gi 183220212 161 IDASIRAKLAGTREALLQKKIPVGAFE 187
gi 116328616 158 IEKSIASQLGEIKKAMLEKKLPVGAVY 184
gi 116331345 158 IEKSIASQLGEIKKAMLEKKLPVGAVY 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap