Conserved Protein Domain Family
atpC

?
PRK13444: atpC 
F0F1 ATP synthase subunit epsilon; Provisional
Statistics
?
PSSM-Id: 139576
View PSSM: PRK13444
Aligned: 6 rows
Threshold Bit Score: 206.267
Threshold Setting Gi: 189910334
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45657127    1 MSANKLKVSVISPEKILYKGEVDSLIVPGSEGFFGILPNHAPLVATLGIGILEIRKGEKLKVLSVEGGFVEIKDNSISIL 80
gi 24215475    1 MSANKLKVSVISPEKILYKGEVDSLIVPGSEGFFGILPNHAPLVATLGIGILEIRKGEKLKVLSVEGGFVEIKDNSISIL 80
gi 189910334   1 -MSKELTLTVISPDKILYQGKAESVILPGAVGYFGILPGHATLVSQLDFGLIKLHTAGKEFRIAIDGGFCEVKNDQIRVL 79
gi 183220216   1 -MSKELTLTVISPDKILYQGKAESVILPGAVGYFGILPGHATLVSQLDFGLIKLHTAGKEFRIAIDGGFCEVKNDQIRVL 79
gi 116328612   1 MFAHKLNVSVISPEKILYKGEVDSLVVPGSEGFFGILPNHAPLVATLGIGVLEIRKGEKLKNISVEGGFIEVKDNTVSIL 80
gi 116331341   1 MFAHKLNVSVISPEKILYKGEVDSLVVPGSEGFFGILPNHAPLVATLGIGVLEIRKGEKLKNISVEGGFIEVKDNTVSIL 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 45657127   81 TDHGALKEDIDLEVEKKNLAEAEKLPPSDSKNLFLQKTKTRILVASR 127
gi 24215475   81 TDHGALKEDIDLEVEKKNLAEAEKLPPSDSKNLFLQKTKTRILVASR 127
gi 189910334  80 TEGGDSEDDLSHDHAIELLQEAEALPTSKEKENLLKKAKVRILLHER 126
gi 183220216  80 TEGGDSEDDLSHDHAIELLQEAEALPTSKEKENLLKKAKVRILLHER 126
gi 116328612  81 TDHGALKEDIDIEAEKKALAEVEKLSPSDSKNLLLQKTKTRILVASR 127
gi 116331341  81 TDHGALKEDIDIEAEKKALAEVEKLSPSDSKNLLLQKTKTRILVASR 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap