Conserved Protein Domain Family
atpC

?
PRK13448: atpC 
F0F1 ATP synthase subunit epsilon; Provisional
Statistics
?
PSSM-Id: 139579
View PSSM: PRK13448
Aligned: 13 rows
Threshold Bit Score: 215.793
Threshold Setting Gi: 92116486
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 92116486    1 MTRFQVSLVSPESLLFSGQVDQVDLPGIEGDLGVLAGHAPIVVMLRPGIVTTVAGDIRDRFVILGGLAEFSQGELTILAD 80
gi 146337565   1 MATFHFDLVSPEKIAFSGEVDQVDVPGQEGDFGVLAGHAPFVATLRPGILTVTTGGTQQKIIVLGGLAEISEKGLTILAD 80
gi 148252016   1 MATFHFDLVSPEKIAFSGEVDQVDVPGQEGDFGVLAGHAPFVATLRPGILTVTAGGTQQKIIVLGGLAEISEKGLTILAD 80
gi 27375550    1 MATFHFDLVSPEKLAFSGEVDQVDIPGVEGDFGVLAGHAPVVAAIRPGILTVTTAGRHEKIIVLGGLAEVSEKGLTVLAD 80
gi 92116149    1 MATFHFDLVSPEKLTFSGDVDQVDVPGVEGDFGVLAGHAPVVAAIRPGILTITTGGTPQKIIVLGGLAEVSEKGLTVLAD 80
gi 75674632    1 MATFHFDLVSPEKLAFSGEVDQVDIPGVEGDFGVLAGHAPVVAAIRPGMLTVTAGGTQQKIIVLGGLAEVSEKGLTVLAD 80
gi 39933252    1 MSTFHFDLVSPEMVAFSGDVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGANKQKIVVLGGIAEVSDKGLTVLAD 80
gi 115522307   1 MATFHFDLVSPEKLAFSGEVDQVDVPGIEGDFGVLANHAPVVAVIRPGILTVITGGNQQKIVVLGGIAEVSEKGLTVLAD 80
gi 90421697    1 MATFQFDLVSPEKLAFSGQVDQVDIPGVEGDFGVLAGHAPVVAVIRPGLLTITAGGNQQKIVVLGGLAEVSDKGLTVLAD 80
gi 91975040   17 MATFHFDLVSPEQVAFSGEVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGGAQQKIVVLGGIAEVSEKGLTVLAD 96
gi 86747390    5 MATFHFDLVSPEMVAFSGEVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGGAQQKIVVLGGIAEVSEKGLTVLAD 84
gi 192288603   1 MSTFHFDLVSPEMVAFSGDVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGANKQKIVVLGGIAEVSDKGLTVLAD 80
gi 209883748   1 MATFHFDLVSPEKIAFSGEVEQVDVPGVEGDFGVLAGHSPLVASVRPGILTVTIGGKHEKIIVLGGLAEVSEKGLTVLAD 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 92116486   81 SASSVDGFDLTRLKAQIDEMQESLAKQsVGDELDRAVAKFDHFKAIHTALAPATAF 136
gi 146337565  81 VATSLKELDQTAFATEISGMEAKLNEK-QGDELDRAIERLDHFKTIQQQLNTTALH 135
gi 148252016  81 VATSLKELDQTAFAAEISGMEAKLNEK-QGNELDRAIERLDHFKTIQQQLNTTALH 135
gi 27375550   81 VATSLDELDRAQFAETIAEMEEGLKEH-EGGELDLAIERLDHYKSIQQQLSSTAMH 135
gi 92116149   81 VATSIQELDRAQFADTIASMEAKLAEK-EGSELDKAIERLDHFKSIQSQLNTTALH 135
gi 75674632   81 VATSIEELDRAQFADTIAGMEARLTDK-EGSELDKAIERLDHFKSIQSQLNTTAMH 135
gi 39933252   81 VATPAPDVDLQDFAATIQTMEQQIPGK-VGDELDRAIERLDHFKSIQHELNTTAMH 135
gi 115522307  81 VATSVADLDAAMFAQTVSSMESALAGK-QGSELDRAIERLDHYKNIQHQLTATAMH 135
gi 90421697   81 VATSVAELDTAQFAQTISSMESSLAGK-QGSELDRAIERLDHYKSIQHQLNATAMH 135
gi 91975040   97 VATAVADLDMQDFAATIATMEQQLPGK-VGDVLDRSIERLDHYKSIQHQISTTAMH 151
gi 86747390   85 VATATADVDMQDFAETITTMEQQLPGK-VGDELDRSIERLDHYKSIQHQLSTTAMH 139
gi 192288603  81 VATPAPDVDLQDFAATIQTMEQQIPGK-VGDELDRAIERLDHFKSIQHELNTTAMH 135
gi 209883748  81 TATSLADLDRAAFARQIEEMESNLKNEePGNELDKAIARLDHFKVIQQHITSTGMH 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap