Conserved Protein Domain Family
atpC

?
PRK13452: atpC 
F0F1 ATP synthase subunit epsilon; Provisional
Statistics
?
PSSM-Id: 106409
View PSSM: PRK13452
Aligned: 9 rows
Threshold Bit Score: 235.025
Threshold Setting Gi: 167627187
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118498207   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIM 80
gi 167627187   1 MTKKYLKVDVVSPLGSVFKGEADIVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDEHTDVLYVSGGIVEVTPTRVTIM 80
gi 56707244    1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIM 80
gi 110669714   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIM 80
gi 134301279   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIM 80
gi 89257057    1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIVYGHTELLSTLPAGVVNVRKGQHTDVLYVSGGIVEVTPTRVTIM 80
gi 115315413   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIVYGHTELLSTLPAGVVNVRKGQHTDVLYVSGGIVEVTPTRVTIM 80
gi 156503267   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIVYGHTELLSTLPAGVVNVRKGQHTDVLYVSGGIVEVTPTRVTIM 80
gi 187931021   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIM 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 118498207  81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
gi 167627187  81 VDDMERAENLNQAEAEKARARAQEALKNPDASKLDIEAASKRLSEADARLKALNSSKGLYYSKED 145
gi 56707244   81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
gi 110669714  81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
gi 134301279  81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
gi 89257057   81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
gi 115315413  81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
gi 156503267  81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
gi 187931021  81 VDDMERAENLNQAEAEKARVRAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap