Conserved Protein Domain Family
PRK13484

?
PRK13484: PRK13484 
putative iron-regulated outer membrane virulence protein; Provisional
Statistics
?
PSSM-Id: 139605
View PSSM: PRK13484
Aligned: 5 rows
Threshold Bit Score: 1365.08
Threshold Setting Gi: 197285796
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117625231   1 MKNKYIIAPGIAVMCSAVISSGYA--SSDKKEDTLVVTASGFTQQLRNAPASVSVITSEQLQKKPVSDLVDAVKDVEGIS 78
gi 26250982    1 MKNKYIIAPGIAVMCSAVISSGYA--SSDKKEDTLVVTASGFTQQLRNAPASVSVITSEQLQKKPVSDLVDAVKDVEGIS 78
gi 197285796   1 MKFK------ISALTACILMTSYSlhAQEDKVERLVVSASGFAQQQTDAPASITVINKEQLEKKPIHDLADAVKGVEGVS 74
gi 218691198   1 MKTKSIIAPGIAVICSTVISSGYA--SSDKKEDTLVVTASGFTQQLRNAPASVSVITSEQLQKKPVSDLVDAVKDVEGIS 78
gi 218559993   1 MKNKYIIAPGIAVMCSAVISSGYA--SSDKKEDTLVVTASGFTQQLRNAPASVSVITSEQLQKKPVSDLVDAVKDVEGIS 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117625231  79 ITGGNEKPDISIRGLSGDYTLILVDGRRQSGRESRPNGSGGFEAGFIPPVEAIERIEVIRGPMSSLYGSDAIGGVINIIT 158
gi 26250982   79 ITGGNEKPDISIRGLSGDYTLILVDGRRQSGRESRPNGSGGFEAGFIPPVEAIERIEVIRGPMSSLYGSDAIGGVINIIT 158
gi 197285796  75 VNGNANKQEITIRGLPGEYTLILVDGRRQNSRESRPNGSGGYEGGFIPPADAIERIEVIRGPMSSLYGSDAMGGVINIIT 154
gi 218691198  79 ITGGNEKPDISIRGLSGDYTLILVDGRRQSGRESRPNGSGGFEAGFIPPVEAIERIEVIRGPMSSLYGSDAIGGVINIIT 158
gi 218559993  79 ITGGNEKPDISIRGLSGDYTLILVDGRRQSGRESRPNGSGGFEAGFIPPVEAIERIEVIRGPMSSLYGSDAIGGVINIIT 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117625231 159 KPVNNQTWDGVLGLGGIIQEHGKFGNSTTNDFYLSGPLIKDKLGLQLYGGMNYRKEDSISQGTPAKDNKNITATLQFTPT 238
gi 26250982  159 KPVNNQTWDGVLGLGGIIQEHGKFGNSTTNDFYLSGPLIKDKLGLQLYGGMNYRKEDSISQGTPAKDNKNITATLQFTPT 238
gi 197285796 155 KPVTKE-WHGAVSMGGTLQHNRDAGDSINGDFYLSGPLIEDKLGLQLYGSSYLRAEDKITYGQGRNDNKNITAKLAFTPT 233
gi 218691198 159 KPVNNQTWDGVLGLGGIIQEHGKFGNSTTNDFYLSGPLVKDKLGLQLYGGMNYRKEDSISQGTPAKNNKNITATLQFTPT 238
gi 218559993 159 KPVNNQTWDGVLGLGGIIQEHGKFGNSTTNDFYLSGPLIKDKLGLQLYGGMNYRKEDSISQGTPAKDNKNITATLQFTPT 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117625231 239 ESQKFVFEYGKNNQVHTLTPGESLDAWTMRGNLKQPNSKRETHNSRSHWVAAWNAQGEILHPEIAVYQEKVIREVKSGKK 318
gi 26250982  239 ESQKFVFEYGKNNQVHTLTPGESLDAWTMRGNLKQPNSKRETHNSRSHWVAAWNAQGEILHPEIAVYQEKVIREVKSGKK 318
gi 197285796 234 DNQTILLEAGRNSLQRTTTPGKSMSEFTNRGGRLDKNKMLETNNDRNHWALTYKNQFDILHSELSVYQEQTKRVQKTEGV 313
gi 218691198 239 ESQKFVFEYGKNNQEHTLTPGDSLDAWTMRGNLKQPNSKRETHNSRSHWVAAWNAQGEILHPEIAVYQEKVIREVKSGKK 318
gi 218559993 239 ESQKFVFEYGKNNQVHTLTPGESLDAWTMRGNLKQPNSKRETHNSRSHWVAAWNAQGEILHPEIAVYQEKVIREVKSGKK 318
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117625231 319 DKYNHWDLN-YESRKPEITNTIIDAKVTAFLPENVLTIGGQFQHAELRDDSATGKKTTETQSVSIKQKAVFIENEYAATD 397
gi 26250982  319 DKYNHWDLN-YESRKPEITNTIIDAKVTAFLPENVLTIGGQFQHAELRDDSATGKKTTETQSVSIKQKAVFIENEYAATD 397
gi 197285796 314 DKATGNSYKyYEDRRPEITNTVFDAKFTAFLPDNVMTFGGQYQYARLKDESSVGGKEVKQSTITADQKALFLEDEFSVTD 393
gi 218691198 319 DKYNHWDLN-YESRKPEITNTIIDAKVTAFLPENVLTIGGQFQHAELRDDSATGKKTTETQSVSVKQKAVFIENEYAATD 397
gi 218559993 319 DKYNHWDLN-YESRKPEITNTIIDAKVTAFLPENVLTIGGQFQHAELRDDSATGKKTTETQSVSIKQKAVFIENEYAATD 397
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117625231 398 SLALTGGLRLDNHEIYGSYWNPRLYAVYNLTDNLTLKGGIAKAFRAPSIREVSPGFGTLTQGGASIMYGNRDLKPETSVT 477
gi 26250982  398 SLALTGGLRLDNHEIYGSYWNPRLYAVYNLTDNLTLKGGIAKAFRAPSIREVSPGFGTLTQGGASIMYGNRDLKPETSVT 477
gi 197285796 394 NLALTGGIRLDDHEYYGKHWNPRAYAVYHLTDEFTIKGGIAKAFKAPSLREISPQYGTSTEKGRAIMYGNRDLKPETSVS 473
gi 218691198 398 SLALTGGLRLDNHEIYGSYWNPRLYAVYNLTDNLTLKGGIAKAFRAPSIREVSPGFGTLTQGGASIMYGNRDLKPETSVT 477
gi 218559993 398 SLALTGGLRLDNHEIYGSYWNPRLYAVYNLTDNLTLKGGIAKAFRAPSIREVSPGFGTLTQGGASIMYGNRDLKPETSVT 477
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117625231 478 EEIGIIYSNDSGFSASATLFNTDFKNKLTSYDIGTKDPVTGLNTFIYDNVGEANIRGVELATQIPVYDKWHVSANYTFTD 557
gi 26250982  478 EEIGIIYSNDSGFSASATLFNTDFKNKLTSYDIGTKDPVTGLNTFIYDNVGEANIRGVELATQIPVYDKWHVSANYTFTD 557
gi 197285796 474 QEIGVGYDNGDGFTANVTFFNTEFKDKLTNYDTGEIDPITGLKLYQYDNVGKANIKGIETAVAFPVADNWRVSANYTYIN 553
gi 218691198 478 EEIGIIYNNDSGFSASATLFNTDFKNKLTSYDIGTKDPVTGLNTFIYDNVGEANIRGVELATQIPVYDKWRVSANYTFTD 557
gi 218559993 478 EEIGIIYSNDSGFSASATLFNTDFKNKLTSYDIGTKDPVTGLNTFIYDNVGEANIRGVELATQIPVYDKWHVSANYTFTD 557
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 117625231 558 SRRKSDDESL-NGKSLKGEPLERTPRHAANAKLEWDYTQDITFYSSLNYTGKQIWAAQRNGAKVPRVRNGFTSMDIGLNY 636
gi 26250982  558 SRRKSDDESL-NGKSLKGEPLERTPRHAANAKLEWDYTQDITFYSSLNYTGKQIWAAQRNGAKVPRVRNGFTSMDIGLNY 636
gi 197285796 554 SKRKSDDEKLgSGESLKGYPLDMTPKHSANARVDWQYDEATSFYANTAYTGKQIWAAQRNGYTGARYRSGYTTFDLGMTY 633
gi 218691198 558 SRRESDDESL-NGKSLKGEPLERTPRHAANAKLEWDYTQDITFYSSLNYTGKQIWAAQRNGAKVPRVRNGFTSMDIGMNY 636
gi 218559993 558 SRRKSDDESL-NGKSLKGEPLERTPRHAANAKLEWDYTQDITFYSSLNYTGKQIWAAQRNGAKVPRVRNGFTSMDIGLNY 636
                        650       660       670       680
                 ....*....|....*....|....*....|....*....|....*.
gi 117625231 637 LILPDTLINFAVLNVTDRKSEDIDTIDGNWQVDEGRRYWANVRVSF 682
gi 26250982  637 QILPDTLINFAVLNVTDRKSEDIDTIDGNWQVDEGRRYWANVRVSF 682
gi 197285796 634 NFNKNTMLNLAVLNITDETGPAVNDKGGNWVVDEGRRYWANIKYSF 679
gi 218691198 637 QFLPGTLINFAVLNVTDRKSEDIDTIDGNWQVDEGRRYWANVRISF 682
gi 218559993 637 LILPDTLINFAVLNVTDRKSEDIDTIDGNWQVDEGRRYWANVRVSF 682
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap