Conserved Protein Domain Family
PRK13486

?
PRK13486: PRK13486 
bifunctional enterobactin receptor/adhesin protein; Provisional
Statistics
?
PSSM-Id: 139606
View PSSM: PRK13486
Aligned: 18 rows
Threshold Bit Score: 1372.41
Threshold Setting Gi: 157145392
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15830614    1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80
gi 73853323    1 MRITILASVVIPCLGFSASCMA-AEDVMIVSASGYEKKLTNAAASVSVINQEELQSSQYHDLAEALRSVEGVDVESGTGK 79
gi 26249445    1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80
gi 170684240   1 MRVTTLASVAIPCLGFSVSSMA-AEDVMVVTASGYEKKLTSAAASVSVISQEDLRSSQYHDLGEALRSVEGVDVESGTGK 79
gi 218691207   1 MRITTLASVIIPCLGFSASSMAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSRQYHDLAEALRSVEGVDVESGTGK 80
gi 218697870   1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80
gi 218706513   1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80
gi 254792370   1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80
gi 260867353   1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80
gi 260857104   1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15830614   81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
gi 73853323   80 TGGLEVSIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITKKN 159
gi 26249445   81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
gi 170684240  80 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGYAAMNTGFMPPLAAIERIEIIRGPMSTLYGSDAMGGVVNIITKKN 159
gi 218691207  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
gi 218697870  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
gi 218706513  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
gi 254792370  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
gi 260867353  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
gi 260857104  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15830614  161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
gi 73853323  160 ADKWHSSINAGLNQQESNKWGNSSQFNFWSSGPLVDDSVSLQIRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 239
gi 26249445  161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
gi 170684240 160 ADKWRSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSLSLQVRGSTQQRQGSSVTSLSDTSATRIPYPTESQNYNAGGR 239
gi 218691207 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWTSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNIGAR 240
gi 218697870 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
gi 218706513 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
gi 254792370 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
gi 260867353 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
gi 260857104 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15830614  241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
gi 73853323  240 IDWKTTEQDMLWFDMDTTRQRYDNRDGQLGSLTGGYDHTLRYERNKISAGYDHAFTFGTWKSYLNWNETENKGRELVRSV 319
gi 26249445  241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
gi 170684240 240 LDWKATDKDVLWIDMDIARQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGAWKSSLNWNETENKGRQLVRSV 319
gi 218691207 241 LDWKATEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHSFTFGTWKSYLNWNETENKGRELVQSV 320
gi 218697870 241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
gi 218706513 241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
gi 254792370 241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
gi 260867353 241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
gi 260857104 241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRNV 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15830614  321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
gi 73853323  320 LKSDKWGLAGKPRELKESNLILNSLLLTPLGESHLVTVGGEYQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 399
gi 26249445  321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
gi 170684240 320 LQRDKWGLAGQPRELKESNLILSSLLFAPLGESHKVTVGGEYQNSSMKDGVVLASTGETFRQKSWSAFVEDEWYITDAFA 399
gi 218691207 321 LKRDKWELAGQPRELKESNFILNSLLLTPLGESHLVTVGGEYQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
gi 218697870 321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
gi 218706513 321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
gi 254792370 321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
gi 260867353 321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
gi 260857104 321 LKRDKWGLAGQLRELKESNLILNSLLLTPLGESHLVTVGGEYQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15830614  401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPDLKPEESVSYEA 480
gi 73853323  400 LTAGSRYEHHEQFGGHLSPRAYLVWDVTDAWTLKGGVTTGYKAPSMGQLHKGISGVSGQGRTNLLGNPELKPEESVSYEA 479
gi 26249445  401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPNLKPEESVSYEA 480
gi 170684240 400 LTAGSRYERYEVFGGHFSPRAYMVWDVTDAWTLKGGVTTGYKAPSMGQLHKGISGVSGQGRTNLLGNPDLKPEESVSYEA 479
gi 218691207 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPTMGQLHKGISGVSGQGRTNLLGNPELKPEESVSYEA 480
gi 218697870 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPDLKPEESVSYEA 480
gi 218706513 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPNLKPEESVSYEA 480
gi 254792370 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPDLKPEESVSYEA 480
gi 260867353 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPDLKPEESVSYEA 480
gi 260857104 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPDLKPEESVSYEA 480
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15830614  481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
gi 73853323  480 GVYYDNLAGLNANITGFITDFSNKIVSYSIDDNTNSYTNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTQSEQRDGDNK 559
gi 26249445  481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
gi 170684240 480 GVYYDNHAGLNANITGFMTEFSNKIVSYSIDDNTRSYTNSGKARTQGVEFAGTLPLLSEDVTLSLNYTWTQSEQRDGDNK 559
gi 218691207 481 GVYYDNLSGLNANITGFITDFSNKIVSYSIDDNTNSYTNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
gi 218697870 481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
gi 218706513 481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
gi 254792370 481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
gi 260867353 481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
gi 260857104 481 GVYYDNPAGLNANITGFMTDFSNKIVSYSINDNTNSYINSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15830614  561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
gi 73853323  560 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRDKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGMSWKVTDTLA 639
gi 26249445  561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
gi 170684240 560 GAPLSYTPEHMVNAKLNWQITEEVTSWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVLDAGMSWKVTDALM 639
gi 218691207 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRDKTPRFTRNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKVTDALT 640
gi 218697870 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
gi 218706513 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
gi 254792370 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
gi 260867353 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
gi 260857104 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKVTDALT 640
                        650       660       670       680       690
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 15830614  641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
gi 73853323  640 LNAAVNNVLNKDYSDVSLYRAGSSTLYAGDYFQTGASTTGYVIPERNYWMSLNYQF 695
gi 26249445  641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
gi 170684240 640 LNAAVNNVLNKDYSDVSLYRAGSGTLYAGDYFQTGASTTGYVIPERNYWMSLNYQF 695
gi 218691207 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
gi 218697870 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
gi 218706513 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
gi 254792370 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
gi 260867353 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
gi 260857104 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap