Conserved Protein Domain Family
PRK13560

?
PRK13560: PRK13560 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 106506
View PSSM: PRK13560
Aligned: 2 rows
Threshold Bit Score: 1377.45
Threshold Setting Gi: 77920301
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118581414   6 SQSVIdrltealrkaregdctlllevadggdDIDALSREVRLLVESMRGHA-DARAVAEAELRECRESC-RRLKANIPGM 83 
77920301    1 MQTIL--------------------------AIEGVGHDVEELQELLRNHGyDIRTITESSAQDERQQYeRNVLENVPIG 54 
118581414  84 VYLFALHPDgtfsfpsVSDASGELFAIAPHElmADVGLLTRLIHPDDRDRFFASVRRSAETLA------PWREEIRHIVH 157
77920301   55 MFRFSLDGK-------LLEANQTLADMCKYD--SPKQMVAMVNGGEGGGFIHANPFRSQQVIAmalqsdDWQSFEGRFRC 125
118581414 158 GEVRWYDCISRPERHANGDIVWDGIILEITGRKraeeRLSEQLHFLQQLLDTIPLPVFYKDTDGVYLGCNSAFELFCGFS 237
77920301  126 KDGSFIDTCLRFRRVPHAQDQVEGFAEDITERK----RIDEALRFTQYVVENTADQAFWLTEDAKVFYVNDAACRALGYR 201
118581414 238 RERIVGRTVHDLAPSQRADVYqEADAALFDAPGVQVYEAEFQNRDGSTR--DVIFNKATFVDPENRVAglvgAITDISGR 315
77920301  202 REELIGMSIHEFDPAYPIKDY-SLNWEKLRPDGSRIIETWHRTKGGRVYpvEVRINHVEFDGKEYHCT----FVTDISRR 276
118581414 316 RRAERELLLKNDMLRAIIQAAPTAIIGLDLDGNVCNVWNPAAErmlgwsaaevmgkpLPGMDPEQREEF--RDFQEW--- 390
77920301  277 RATETILRESENRYRQLMEMLPIAAYTTDADGRITFYNRNAAE--------------LWGRKPELNKELwcGSFRLWypd 342
118581414 391 --------------IRGGRILDGVEVRRHRQDGSPMDCSIYASPLHDTEGRIVGSIAVLVDITERKQVEESLRLANLIVE 456
77920301  343 grpmafdacpmaktLKQGKRFQGQEVLIEREQDGYAHVVAYPEPLYDADGNLIGALNLLVDITVRKQVEQQLLQANLVVE 422
118581414 457 NSPLVLFRWRATEGWPVELVSRNVTRFGYTPDELITGVVPFSALVHPDDLRQVAAEVAEFVRQGVDRFQQEYRIVTKGGA 536
77920301  423 NSPVVLFRWKAEPGWPVVLVTKNITQFGYEPEEFLSGKRMFASIIHPADRERVAREVEVFAARGVDRFEQQYRILGRGGK 502
118581414 537 VRWIDDRSAVERDSQGRISHFQGVVLDITERKLAEEKIRAALTEKVVLLKEIHHRVKNNLQIISTLLDLQAESVRDEGAL 616
77920301  503 VCWISDQTNAERDEEGQVTHYEGIVIDISERKHAEERIKASLVEKEVLLKEIHHRVKNNLQVVSSLLYLQAQKLHDPEAK 582
118581414 617 CAFRESQDRIRAMALVHEKLYRTEDLSFIDFSGYIESLTAHLYNSYAIDFGRVSFSIDAGNVCLSIDQAIPCGLIISELV 696
77920301  583 TLFAESQSRICSMALAHEQLYQSKNLADISLLDYVQSLVSHVKQTFMSPQSVIDCKVDVDDGVLDIEKVVPCGLLITELL 662
118581414 697 SNSLKYAFPGSAAGNISVSIREQgDGMVSLTVADSGVGLPVNLDFTASETLGLQLVRMLVKQLRGEIALDSSGGARFSIR 776
77920301  663 SNALKHAFPDGTCGSIKVEITRQ-NGSVNLCVADDGIGLPAGFDYRKAETLGLQLVCALVQQLDGSLSVQSRRGTSFNLS 741
118581414 777 FPmspaG 783
77920301  742 FP----G 744
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap