Conserved Protein Domain Family
ubiA

?
PRK13592: ubiA 
prenyltransferase; Provisional
Statistics
?
PSSM-Id: 139690
View PSSM: PRK13592
Aligned: 3 rows
Threshold Bit Score: 396.915
Threshold Setting Gi: 157150684
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125717848   1 MFKRLAVYYKEMFPLLPRFFVAAIMFFEIYFVLLLNDGVTTFHFDHQELIGIFTIFVFLMILRIADDFKDYETDRRLFPH 80
gi 15894087    1 MIKRLNVYLKEMYPLLPRLILSLTLFFEIYMITLLSNHISSFRIGIQEFVGVFTVFGFWLALRIADELKDYETDKINFPK 80
gi 157150684   1 -----------------------------------------------------------MILRIADDFKDYETDRRLFPH 21
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125717848  81 RALPSGRVKKKDLAIALSFIVAVSVLLNVLFMNNIGWFLFLYIYGTLMSFWFFKRDKIQNSLPLALVTHNPVMMILNLYT 160
gi 15894087   81 RPLPSGRVTKRDLWILLTIDYALMIFLNLVFMNNVLFFIVLLIYGVLMSLWFFAKKYIQPNLVLALITHNPVELILDYYI 160
gi 157150684  22 RALPSGRVKKKDLAIALSFIVAVSVLLNVLFMNNVGWFLFLYIYGTLMSFWFFKRDKIQNSLPLALVTHNPVMMILNLYT 101
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 125717848 161 ISFVCYKYNLPLLSLPTVLLAFTMYFPSLIWEVCRKIRAPKDETEYVTYSKLFGYKKATRFIEVVTLLDILTNFALLWNI 240
gi 15894087  161 ISFACIKYKLPVFTGTTLLICVTLYFPALAWEVSRKIKAPDDENQYVTYSKLFGYKKATMFVMLVIFCEMITTNILAYRL 240
gi 157150684 102 ISFVCYKYNLPLLSLPTVLLAFTMYFPSLIWEVCRKIRAPKDETEYVTYSMLFGYKKATRFIEVVTLLDILTNFALLWNI 181
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 125717848 241 SHVGVVVLVLNVIWMTVQFEQFIKDPTRFNIRERVERYTYITETTMVLSVAVYLLmgVL 299
gi 15894087  241 SIIMVIILTVRYFWLVYNCIEFIKSPKKFKLGKRVEVYLYITALLVLIMEILNLF--VM 297
gi 157150684 182 SHVGVVVLVLNVIWMTVQFEQFIKNPTRFNIRERVERYTYITETTMVLSVAVYLLmgVL 240
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap