Conserved Protein Domain Family
PRK13599

?
PRK13599: PRK13599 
putative peroxiredoxin; Provisional
Statistics
?
PSSM-Id: 106544
View PSSM: PRK13599
Aligned: 5 rows
Threshold Bit Score: 426.052
Threshold Setting Gi: 289577487
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167038390   1 MKLLGEKFPSMEVVTTQGVKRLPEDYAGKWFVLFSHPADFTPVCTTEFVEFARKANDFKELNTELIGLSVDQVFSHIKWV 80
gi 20806791    6 MKLLGEKFPSMEVMTTHGVKRLPEDYAGKWFVLFSHPADFTPVCTTEFVEFARKAEEFKQLNTELIGLSVDQVFSHIKWV 85
gi 167038876   1 MKLLGEKFPSMEVVTTQGVKRLPEDYAGKWFVLFSHPADFTPVCTTEFVEFARKANDFKELNTELIGLSVDQVFSHIKWV 80
gi 289577487   6 MKLLGEKFPSMEVVTTQGVKRLPEDYAGKWFVLFSHPADFTPVCTTEFVEFARKANDFKELNTELIGLSVDQVFSHIKWV 85
gi 297543799   6 MKLLGEKFPSMEVVTTQGVKRLPEDYAGKWFVLFSHPADFTPVCTTEFVEFARKANDFKELNTELIGLSVDQVFSHIKWV 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 167038390  81 EWIKDNTNIAIPFPVIADDLGKVSNQLGMIHPGKGTNTVRAVFIVDDKGTIRLIMYYPQEVGRNVDEILRALKALQTADQ 160
gi 20806791   86 EWIKDNTGVQIPFPVIADELGRVSNQLGMIHPGKGTNTVRAVFIVDDKGVIRLIMYYPQEVGRNVDEILRALKALQTADQ 165
gi 167038876  81 EWIKDNTNIAIPFPVIADDLGKVSNQLGMIHPGKGTNTVRAVFIVDDKGTIRLIMYYPQEVGRNVDEILRALKALQTADQ 160
gi 289577487  86 EWIKDNTNIAIPFPVIADDLGKVSNQLGMIHPGKGTNTVRAVFIVDDKGTIRLIMYYPQEVGRNVDEILRALKALQTADQ 165
gi 297543799  86 EWIKDNTNIAIPFPVIADDLGKVSNQLGMIHPGKGTNTVRAVFIVDDKGTIRLIMYYPQEVGRNVDEILRALKALQTADQ 165
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 167038390 161 YGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKSKEIEAFDWWFVHKPLK 215
gi 20806791  166 YGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKAKEIEAFDWWFVHKPLK 220
gi 167038876 161 YGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKSKEIEAFDWWFVHKPLK 215
gi 289577487 166 YGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKSKEIEAFDWWFVHKPLK 220
gi 297543799 166 YGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKSKEIEAFDWWFVHKPLK 220
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap