Conserved Protein Domain Family
PRK13611

?
PRK13611: PRK13611 
photosystem II reaction center protein Psb28; Provisional
Statistics
?
PSSM-Id: 106556
View PSSM: PRK13611
Aligned: 2 rows
Threshold Bit Score: 182.218
Threshold Setting Gi: 86606087
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86606087   1 MATIEFSPGIPEVPTQVRLLKSKTGKRGSAIFRFEELKSDTQSILGMRMIDEEGELTTRNIKAKFLNGEFKALEVIYDME 80
gi 86609069   1 MASIEFSPGIQEVPTQVRVLKSKTGNRGSAIFRFEDLKSDTQNILGMRMIDEEGELTTRNIRAKFLNGEFKALEVTYDME 80
                        90       100
                ....*....|....*....|....
gi 86606087  81 TEAEWERFLRFMERFSAANQMGMA 104
gi 86609069  81 TEAEWDRFLRFMERFSAANQMGMA 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap