Conserved Protein Domain Family
psbV

?
PRK13617: psbV 
cytochrome c-550; Provisional
Statistics
?
PSSM-Id: 106562
View PSSM: PRK13617
Aligned: 8 rows
Threshold Bit Score: 303.312
Threshold Setting Gi: 148242939
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148242939  11 LPHSMRTVLQGLRRLGALLLLPIALLLLAPaAHAVQWDAETLTVPADASGSTVTFTESEIKAGRKVFNNSCGECHAGGIT 90
gi 113952941  13 MASFFSTLRRSLNRLLIALPVLLGLMISTP-AQAAQWDAETLTVPADGDGALVTFSEQEIKTGRKVFNVSCGTCHAGGIT 91
gi 78184108    1 MVSVFSSLRQSFKGLLVLVPVLIGLAFISP-AEAVQWDAETLTVPVNPDGAEVTFTDREINAGRKVFNTSCGTCHAGGIT 79
gi 148240313   1 MASFLPNVRRSLSRLLIVLSAFAVLVIGTP-AQAASWDAETLTVPADAEGSPVTFSEQQVKAGRKVFNTSCGTCHAGGIT 79
gi 124022241   1 MASLFASLGRSLIKLLIVLPVIIGLSISSP-AMAAQWDAETLTVPAGSGGQQVTFSESEIKSASKLFKSNCATCHNQGVT 79
gi 78213661   17 MASVFSSLRRSLKGLLVLIPVLIGLAVTSP-AQAAQWDAETLTVPADPSGTEVTFSDREIDSGRKVFNTSCGTCHAGGIT 95
gi 33863694    1 MASLFASLGRSLIKLLIVLPVIIGLSISSP-AMAAQWDAETLTVPAGSGGQQVTFTESEIKSASKLFKSNCATCHNQGVT 79
gi 33865073   12 MASLFSTLQRSLKGLLILVPVLIGLVLASP-AEAVRWDAETLTVPGNPEGTQVTFSEQEINTGRKVFNTSCGTCHAGGIT 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148242939  91 KTNQNVGLDPETLALATPPRDSVDALVDYMKDPTSYDGEISIAEFHPSMRSADVFVKMRDLNDEDLRRMAGYILTSPKAQ 170
gi 113952941  92 KTNQNVGLDTETLALATPARDNVASLVDYLQDPTSYDGEYSIADLHPSMRSRDLYPAMRDLTDEDLRLMSGYILVAPKVL 171
gi 78184108   80 KTNQNVGLDPETLALATPARDNVDALVDYMKDPTSYDGEYSISDVHPSMRSAELYPAMRDLDDEDLRLMAGYILVSPKVQ 159
gi 148240313  80 KTNHNVGLDPETLALATPARDNVAALVDYLQDPTSYDGEYSIADLHPSMRSRDLYPAMRDLTDEDLRLMSAYILVAPKVL 159
gi 124022241  80 KTNQNVGLDLEALSLASPARDNVDGLVEFLKNPMSYDGEYSIADTHPGISSSDVYVQMRTLNDEDLRLIAGYILTAEKVQ 159
gi 78213661   96 KTNHNVGLDPETLALATPARDNVEALVDYMKDPTSYDGEYSIADLHPSMRDAELYPAMRDLDDEDLRLMAGYILVSPKVQ 175
gi 33863694   80 KTNQNVGLDLEALSLASPARDNVDGLVEFLKNPMSYDGEYSIADTHPGISSSDVYVQMRTLNDEDLRLIAGYILTAEKVQ 159
gi 33865073   91 KTNQNVGLDPETLALATPARDNVDALVDYMKDPTSYDGEYSIADLHPSMRDAELYPAMRDLTDEELRLMAGYILVAPKVQ 170
                        170
                 ....*....|.
gi 148242939 171 GTQWGGGKIYF 181
gi 113952941 172 GVDWGGGKIYF 182
gi 78184108  160 GSSWGGGKIYF 170
gi 148240313 160 GQEWGGGKIYF 170
gi 124022241 160 GDQWGGGKIYF 170
gi 78213661  176 GSAWGGGKIYF 186
gi 33863694  160 GDQWGGGKIYF 170
gi 33865073  171 GTAWGGGKIYF 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap