Conserved Protein Domain Family
psbV

?
PRK13622: psbV 
cytochrome c-550; Provisional
Statistics
?
PSSM-Id: 106567
View PSSM: PRK13622
Aligned: 2 rows
Threshold Bit Score: 329.735
Threshold Setting Gi: 86606343
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86609971   1 MFSKAFSFQKVFAPARRRLLVLLLAALMAGFGWGlaPVFAARDIPAVALSPTESITFTEAQLAKGKKLFNTACAQCHVGG 80
gi 86606343   1 MFSKFFSLQKAFAAARRRLLILILVLGMAGYAWG--PALAARQIPPVALSPTESITFTEAQLARGKQLFNRACAQCHVGG 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 86609971  81 QTYPNPDVSLKLSDLEGATPPRDNVLAIVDYIKNPVTYDGVESLLEYHPNTQLTSEYPRLRNLTDEDLKLIAGYILVQAK 160
gi 86606343  79 QTYPNPDVTLKLSDLEGATPPRDNVLAIVDYIKNPVTYDGVESLVEYHPNTQLLSEYPRLRNLTDEDLKLIAGYILVQAK 158
                       170       180
                ....*....|....*....|
gi 86609971 161 TVPGWGGTKNESHSDLSAYL 180
gi 86606343 159 TVPGWGGTKSESHSDLSAYL 178
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap