Conserved Protein Domain Family
cbiO

?
PRK13644: cbiO 
cobalt transporter ATP-binding subunit; Provisional
Statistics
?
PSSM-Id: 106587
View PSSM: PRK13644
Aligned: 3 rows
Threshold Bit Score: 560.375
Threshold Setting Gi: 73668130
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21227139   1 MIRLENVSYCYPDGTPALTNINLTIRKGEYLGIIGRNGSGKSTLALHLNGLRRPQKGKVIVKGIDAGDFSKLQEVRKIVG 80 
73668130   1 MIRLEKVSYSYPDGTPALENINLVIKKGEFIGVIGKNGSGKSTLALQLSGLLKPQAGRVLISGIDTCDPSKLPGIRKLVG 80 
20093129   1 MIRLENVSYNYPDGTPALRNINIGIKKGEYIGITGKNGSGKSTLALHLNGLLRPQKGKVLVRGMDTGDFSKLQGIRKLVG 80 
21227139  81 IVFQNPETQFIGRTVEEDLAFGPENLCLPPTEIRKRVDRALAEIKLEKYRHHSPKSLSGGQGQCVALAGVLTMEPECLVF 160
73668130  81 IVFQNPETQFVGRTVEEDLAFGPENLCLPPIEIRKLVDMALAETGLEKYRHRSPKTLSGGQGQCVALAGILAMSPECLIF 160
20093129  81 IVFQNPETQFVGRTVEEDLAFGPENLCLPPIEIRKRVDRALAEIGLGKYRYRSPKTLSGGQGQCVALAGILTMEPDCLIF 160
21227139 161 DEVTSMLDPDSGETVLRRIKKLHEKGKTIVYTTHNLEELHVADRILVMDRGRIVLEGEPENVLSDPSLKDLGLTPPSLIE 240
73668130 161 DEVTSMLDPESGIAVLENIKKLHRKGKTIVYITHNLEELHDADRVIVMEKGKVRLEGEPESIFSDVSLQTLGLALPSLIE 240
20093129 161 DEVTSMLDPDSGKAVLERVKRLHEKGKTIVYITHNLEELQAADRIIVMDRGKIVLEGTPENVLSDLSLRYLGLTPPSLIE 240
21227139 241 LAEQLKKHEIEISWENTSSPSSFAEELCRLFLKT 274
73668130 241 LAENLKMHGVVIPWENTSSPQSFAEEICRLFLKT 274
20093129 241 LAERLKNHGVAVPWEKTSSPSSFAEEICRLFLKT 274
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap