Conserved Protein Domain Family
PRK13691

?
PRK13691: PRK13691 
(3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional
Statistics
?
PSSM-Id: 139768
View PSSM: PRK13691
Aligned: 20 rows
Threshold Bit Score: 284.027
Threshold Setting Gi: 148660411
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118467224   1 MALKTDIRGMIWRYPDYFVVGREQLRQFALSVKNRHPAHFSEDAAAELGHDAIIAPLTFATIFAKLVQLDFFRHVDIGME 80
gi 118616512   1 MALKTDIRGMSWKYPDCFVVGREQVRGFARSVQCDDAACYEEDAAAKLGYGGIVAPMTFVSILAKLVQSDFFRNVDVGME 80
gi 108797894   1 MALKTDIRGMVWKYPDTFVVGREQIRQYAKSVKVTDPATLDEQAAAELGHDALIAPPTFMSIFAVMIQNHFFQHVDVGLE 80
gi 120402244   1 MALKTDIRGMVWEYPDVFVVAREQIRQYANSVKAKDPATHDEAAAAELGHSGIIAPPTFMSIFAVMIQNHFFQHVDVGLE 80
gi 119866989   1 MALKTDIRGMVWKYPDTFVVGREQIRQYAKSVKVTDPATLDEQAAAELGHDALIAPPTFMSIFAVMIQNHFFQHVDVGLE 80
gi 41410207    1 MALKTDIRGMIWRYPDYFVVGREQLRQFALSVKNRHPAHFSEDAAAELGHDAIIAPLTFATIFAKLVQLDFFRHVDIGME 80
gi 126433557   1 MALKTDIRGMVWKYPDTFVVGREQIRQYAKSVKVTDPATLDEGAAAELGHDALIAPPTFMSIFAVMIQNHFFQHVDVGLE 80
gi 145225695   1 MALKTDIRGMVWEYPDVFVVAREQIRQYANAVKAKDPASHDEAAAAELGHGGVVAGPTFMSIFAVMIQNHFFQNVDIGLE 80
gi 183980990   1 MALKTDIRGMSWKYPDCFVVGREQVRGFARSVQCDDAACYEEDAAAKLGYGGIVAPMTFVSILAKLVQSDFFRNVDVGME 80
gi 221230499   1 MALKTDIRGMVWRYSDYFIVGREQCREFARAIKCDHPAYFSEDAAAELGYDAIVAPLTFVTIFAKYVQLDFFRNVDVGME 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 118467224  81 TLVIVQVDQRFVFSKPIKAGDKLWARMDIVSVDERFGADIVVTKNICTNDDGELVLEAYTTLMSQfNGDQSAKLRWDSES 160
gi 118616512  81 TMQIVQVDQRFVFYKPVLAGDKLWARMEVHSVDERFGADIVVTKNVCHNDDGEVVLEAYTTLMGQ-QGDGSAKLKWDKET 159
gi 108797894  81 TLQIVQVDQKFLFHRPIVAGDSLTGTMYIETVDERFGADIVTTRNVLTDSTGAVVMESFTTLMGH-EGDNSISAKWDPET 159
gi 120402244  81 TLQIVQVDQRFLFHRPIKDGDRLRGALTILTVDERFGADIVTTRNVLTDDAGEIVMESFTTLMGH-EGDNSISAGWDPET 159
gi 119866989  81 TLQIVQVDQKFLFHRPIVAGDSLTGTMYIETVDERFGADIVTTRNVLTDSTGAVVMESFTTLMGH-EGDNSISAKWDPET 159
gi 41410207   81 TLVIVQVDQRFVFSKPIKAGDKLWARMDIVSVDERFGADIVVTKNICTNDDGELVLEAYTTLMSQfNGDQSAKLRWDSES 160
gi 126433557  81 TLQIVQVDQKFLFHRPIVAGDALTGTMYIETVDERFGADIVTTRNVLTDPTGAVVMESFTTLMGH-EGDNSISAKWDPET 159
gi 145225695  81 TMQIVQVDQKFLFHRPIKDGDRLRGVMTILTVDERFGADIVTTRNVLTDDAGEVVMESFTTLMGH-EGDNSISAGWDPET 159
gi 183980990  81 TMQIVQVDQRFVFYKPVLAGDKLWARMEVHSVDERFGADIVVTKNVCHNDDGEVVLEAYTTLMGQ-QGDGSAKLKWDKET 159
gi 221230499  81 TMQIVQVDQRFVFHKPVLVGDKLWARMDIHSVSERFGADIVVTKNSCTSDDGELVMEAYTTLMGQ-QGDNSSQLKWDKES 159

                 ....*..
gi 118467224 161 GQVVRTA 167
gi 118616512 160 GQVIRTA 166
gi 108797894 160 GQVVRTA 166
gi 120402244 160 GQVLRKP 166
gi 119866989 160 GQVVRTA 166
gi 41410207  161 GQVVRTA 167
gi 126433557 160 GQVVRTA 166
gi 145225695 160 GQVVRKP 166
gi 183980990 160 GQVIRTA 166
gi 221230499 160 GQVIRSA 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap