Conserved Protein Domain Family
PRK13744

?
PRK13744: PRK13744 
conjugal transfer protein TrbG; Provisional
Statistics
?
PSSM-Id: 139817
View PSSM: PRK13744
Aligned: 18 rows
Threshold Bit Score: 151.054
Threshold Setting Gi: 218692889
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 157418119  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRSTVFENPDIVKTCTVRDLKKDFVNCDEKG 80
gi 58000369   1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKTCTVRDLKNDFVNCDEKG 80
gi 170650806  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKTCTVRDLKNDFVNCDEKG 80
gi 218534543  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRSTVFENPDIVKTCTVRDLKKDFVNCDEKG 80
gi 253801035  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRSTVFENPDIVKTCTVRDLKKDFVNCDEKG 80
gi 256367752  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKTCTVRDLKNDFVNCDEKG 80
gi 260751976  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKTCTVRDLKKDFVNCDEKG 80
gi 268507248  1 MNKLVSDGSVKKINYPVLYESGITPPLYEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKICTVRDLKKDFVNCDEKG 80
gi 302595402  6 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKTCTVRDLKNDFVNCDEKG 85
gi 302595302  6 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRSTVFENPDIVKTCTVRDLKKDFVNCDEKG 85

                ...
gi 157418119 81 EGQ 83
gi 58000369  81 EGQ 83
gi 170650806 81 EGQ 83
gi 218534543 81 EGQ 83
gi 253801035 81 EGQ 83
gi 256367752 81 EGQ 83
gi 260751976 81 EGQ 83
gi 268507248 81 EGQ 83
gi 302595402 86 EGQ 88
gi 302595302 86 EGQ 88
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap