Conserved Protein Domain Family
PRK13792

?
PRK13792: PRK13792 
lysozyme inhibitor; Provisional
Statistics
?
PSSM-Id: 106733
View PSSM: PRK13792
Aligned: 4 rows
Threshold Bit Score: 271.204
Threshold Setting Gi: 15596064
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15596064    1 MKKALWLLLAAVPVVLVACGGSDDDKQTAQVDYLALPGDAKLDTRSVDYKCENGRKFTVQYLNKGDNSLAVVPVSDNSTL 80
gi 152986730   1 MKKALWLLLAAVPVVLVACGGSDDDKQTAQVDYLALPGDAKLDTRSVDYKCENGRKFTVQYLNKGDNSLAVVPVSDNSTL 80
gi 116048791   1 MKKALWLLLAAVPVVLVACGGSDDDKQTAQVDYLALPGDAKLDTRSVDYKCENGRKFTVQYLNKGDNSLAVVPVSDNSTL 80
gi 218893164   1 MKKALWLLLAAVPVVLVACGGSDDDKQTAQVDYLALPGDAKLDTRSVDYKCENGRKFTVQYLNKGDNSLAVVPVSDNSTL 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*..
gi 15596064   81 VFSNVISASGAKYAAGQYIWWTKGEEATLYGDWKGGEPTDGVACKER 127
gi 152986730  81 VFSNVISASGAKYAAGQYIWWTKGEEATLYGDWKGGEPTDGVACKER 127
gi 116048791  81 VFSNVISASGAKYAAGQYIWWTKGEEATLYGDWKGGEPTDGVACKER 127
gi 218893164  81 VFSNVISASGAKYAAGQYIWWTKGEEATLYGDWKGGEPTDGVACKER 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap