Conserved Protein Domain Family
PRK13797

?
PRK13797: PRK13797 
putative bifunctional allantoicase/OHCU decarboxylase; Provisional
Statistics
?
PSSM-Id: 106738
View PSSM: PRK13797
Aligned: 4 rows
Threshold Bit Score: 812.665
Threshold Setting Gi: 162454153
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158317428   1 MTDAPDLTNLVDLAAARFGGSVVAVNDEFFALAERMLLAEAPIVRPGVFTERGQWTDGWETRRRRDLPAADWAIVRLGAP 80
gi 111220914  14 MSDEPDLTNLVDLAAARSGGTVVAVNDEFFAFAERMLLPEPPVVRPGVFTERGQWTDGWETRRRRDLPGADWAIVRLGAP 93
gi 86739553    1 MSDAPDLTNLVDLAAARFGGTVVAVNDEFFAFAERMLLPEPPIVRPGVFTERGQWTDGWETRRRRDLPGSDWAIIRLGSP 80
gi 162454153   6 GVTGPAFAEALDLASERLGGAVLAANDEFFAPKENLLKAGKAVFLEHEYTDRGKWMDGWETRRRRT-PGFDWCLVRLGLP 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158317428  81 GIVHAVTVDTTHFTGNAPESVELHGATLAGYPSAEDVAEDSVTWVPLVARTPVAADAVNVLPVSAEGRLRISHLRLTIHP 160
gi 111220914  94 GIAHAITVDTTHFTGNAPEAVEIHGATVAGYPSAAEVADDAVDWVELVPRTPITADAVNVLPVAEAGRLRITHLRLTIHP 173
gi 86739553   81 GIAHAVTVDTTHFTGNAPGAVEVHGATLPGYPSAAEVAEESVAWVPLVPRTPIVPDAANVLPVADQGRTRITHLRLTIHP 160
gi 162454153  85 GILRGVIVDTAFFRGNYPEHCSIEACAARPDARVEDLLDPRTHWVEILPRSPLAGDSQNAFELTSSSRF--THLRLNIYP 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158317428 161 DGGVARLRVHGVVVPDPRLLDR--VTSDLAAAYLGGVVVAASDMHYGDRHNLNASGDARAMGEGWETRRRRGPGHDWAVV 238
gi 111220914 174 DGGVARLRVHGTVVPDPRLLDR--VTSDLAAAYLGGVVVAASDMHYGDRHNLNASGDARAMGEGWETRRRRGTGHDWAAV 251
gi 86739553  161 DGGVARLRVHGTVVPDPRMFDR--VTSDLAAAYLGGVVVAASDMHYGDRHNLNASGEARAMGEGWETRRRRGDGHDWAVV 238
gi 162454153 163 DGGVARLRVHGDALPDVRRQGRpgAEIDLAAAENGGRVLSCSDMFFGVRHNLIMPGRAANMGDGWETRRRRGPGYDWALV 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158317428 239 RLATEGTVVRAEVDTRHFRGNAPRAVALWAANAPttgdDDLATDALSAITDWRPLLPRTRVQPNTRHLFDLEVPVEA--T 316
gi 111220914 252 RLTTQGLIVRAEVDTRHFRGNAPRAVELWAADYP----DLLDPDDIDAITEWVPLLPRTRVQPNTRHLFDLEVPVQA--T 325
gi 86739553  239 RLATQGTIVRAEVDTRHFRGNAPRAVALWAADNP----DLLDPDDVTAITEWYPMLPRTRVQPNTRHLFDLEVPIQA--T 312
gi 162454153 243 ALAAQGEIARIEVDTNHFKGNYPDSCMIEGIDAA-----GRSAAELAGAGGWREIVPRTKLQAHTRHLFEEDLRATGpfT 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158317428 317 HVRVDAIPDGGLARLRLVGAPTEAGRESLAMRWFDSLTPAAAREELLACCGSEDWADAVTALRPFDTLATLLPAAEQEWW 396
gi 111220914 326 HVRVDAIPDGGLARLRLTGVPTATGREALAMRWFDALSPDAAREELLACCESEDWAEAVVARRPFGTLAALLPAAEQEWW 405
gi 86739553  313 HVRVDAIPDGGLARLRLTGAPTPVGREALAMRWFDALSPDAAREELLACCESEDWAAAVAARRPFGTLAALLPAAEQEWW 392
gi 162454153 318 HVRLNIYPDGGVSRLRIFGEATRSGAAEQRLRWLNALTEPEAEAELRVACGASAWASQVAAARPFRDEEHLSAAAAQAFA 397
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 158317428 397 NLPETAWLEAFTAHPRIGERPTPAPTPPTSSRATVVSLDAPRREQAALDQASEDVRAAFAEGNAEYEDRFGFIFLVRAAG 476
gi 111220914 406 RLPESAWFEAFTAHPRIGERPTGIPAPPTTSRASVVSLDAPRREQAAMDEAPEAIKAAFVSGNAAYEERFGYIFLVRAAG 485
gi 86739553  393 NLPASAWLEAFTAHPRIGERPAHTPAPPTTARATVVSLDAPRREQAAMDQATAEVRAAFEQGNAAYEERFGYIFLVRAAG 472
gi 162454153 398 RLAPEDWLEAFRAHPRIGETRPQAEAAEASATARRFS----SQEQAGMSAAAVDTREALARLNRAYDEKFGFIYIVCATG 473
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....
gi 158317428 477 RGAQEMLELLRERMANDPRTELRVAAGQQAEITALRLRHLITGA 520
gi 111220914 486 RGAEEMLALLQERMAHEPDEELRIAAGQQAEITALRIRHLITGA 529
gi 86739553  473 RDAEEMLALLRARLDNDPADELRIAAGQQAEITALRIRRLITGA 516
gi 162454153 474 KSADEMLEALRARLEHTQEQELPIAADEQRKITAIRLKKLLWGG 517
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap