Conserved Protein Domain Family
PRK13799

?
PRK13799: PRK13799 
unknown domain/N-carbamoyl-L-amino acid hydrolase fusion protein; Provisional
Statistics
?
PSSM-Id: 106740
View PSSM: PRK13799
Aligned: 2 rows
Threshold Bit Score: 1140.51
Threshold Setting Gi: 152981424
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160897552   1 MALTLEQLNAADLATAASLLDGLYEHSPWIAEAALAQRPFRSLAQIKYAMAQVLDKAPVQAKLDLIRAHPELAGKAMETN 80
gi 152981424   3 TLEQLNRLAAQDVPAFVDTLRGIYEHSPWIPERAAKLGPFPTITALKQALQGVVSAADRAEQLQLIRAHPELAGKAAIAG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160897552  81 TLTAESTNEQNKAGLTRCTPEELEHIRKLNAEYGKRFGFPFILAVRGPRGAGLAKAEIIETFERRLHNHPDFELGEALRN 160
gi 152981424  83 ELTVESTGEQAKAGLNLCTPEEFAALQNLNNDYNKKFGFPFILAVKGATGKGLTRQQIIATFTRRLRNQVEDELREALRQ 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160897552 161 IHRIAEIRLNDKFGYTPELGNDVWDWQEKLAQHSDpgyaEKGQLTVTYLTDAHRACAQRISHWMRDCGFDeVEIDAVGNV 240
gi 152981424 163 IGRIAEMRINDLLGYTPAIGALVMDWAEDIAAWSE----DEGALTCTYMSDAHRRTANQISDWMRTAGMH-VHIDAVGNV 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160897552 241 VGRYKAATDDARTLLTGSHYDTVRNGGKYDGRLGIFVPMACVRELHRQGKRLPFHIEVVGFSEEEGQRYKATFLGSGALI 320
gi 152981424 238 VGRYLATDPRAKTLITGSHYDTVRNGGKYDGREGILLAIAVVKHLHERGETLPFHFEVIAFAEEEGVRFKSTFLGSNAVI 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160897552 321 GDFRQEWLEQKDADGITLREAMQHAGLCIDDIPKLQRDPARYLGFIEVHIEQGPVLNELDIPLGIVTSINGSARYICEMI 400
gi 152981424 318 GQFNMELLDITDRDGISMREAITQAGHDVNAIPQIARNPADVLGYVEVHIEQGPVLLQRDLPVGIVTSIAGSSRYQVEFR 397
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160897552 401 GMASHAGTTPMDRRRDAACGVAELALYIEKRAARD--GTSVATMGQLNVPSGSVNVVPGRCQFSLDLRAPTNEQRDAMVA 478
gi 152981424 398 GVASHSGTTPMSMRKDAAAAAAEIILYVEQRCAQDqhASLVGTVGQLQVPSGSTNVIPGRCVFSLDIRAAVDSIREAAVA 477
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 160897552 479 DILAEIEAIAQRRGLRYSTELAMKAAAAPSAPEWQQRWEAAVDALGVPLYRMPSGAGHDAMKLHEIMPQAMLFVRGLNAG 558
gi 152981424 478 DILQHIADVCARRNIEYKAELSVSAPAAPCAPWLMKQLSAATERAGVRPFELASGAGHDAMTIAKMTDVAMLFTRCGNGG 557
                        570       580       590
                 ....*....|....*....|....*....|.
gi 160897552 559 ISHNPLESSTADDMQLSVDAFSHVLNQLAQE 589
gi 152981424 558 ISHNPLETMTADDTEVSAQILLDFLRNFKEK 588
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap