Conserved Protein Domain Family
pyrB

?
PRK13814: pyrB 
aspartate carbamoyltransferase catalytic subunit; Provisional
Statistics
?
PSSM-Id: 139876
View PSSM: PRK13814
Aligned: 5 rows
Threshold Bit Score: 618.272
Threshold Setting Gi: 29655373
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29655373    1 MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTRNSFEIAAKRLGAMVLNPNLK 80
gi 161831597   1 MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTRNSFEIAAKRLGAMVLNPNLK 80
gi 154705998   1 MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTRNSFEIAAKRLGAMVLNPNLK 80
gi 212219593   1 MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVVNLFFEPSTRTRNSFEIAAKRLGAMVLNPNLK 80
gi 212213539   1 MNELPLHLLNMRSLTRDHIEKLIQRANYFLTQGMEKNSVFETLKGHVVANLFFEPSTRTRNSFEIAAKRLGAMVLNPNLK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29655373   81 ISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCV 160
gi 161831597  81 ISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCV 160
gi 154705998  81 ISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCV 160
gi 212219593  81 ISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCV 160
gi 212213539  81 ISAISKGETLFDTIKTLEAMGVYFFIVRHSENETPEQIAKQLSSGVVINAGDGNHQHPSQALIDLMTIKQHKPHWNKLCV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29655373  161 TIIGDIRHSRVANSLMDGLVTMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF 240
gi 161831597 161 TIIGDIRHSRVANSLMDGLVTMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF 240
gi 154705998 161 TIIGDIRHSRVANSLMDGLVTMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF 240
gi 212219593 161 TIIGDIRHSRVANSLMDGLVTMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF 240
gi 212213539 161 TIIGDIRHSRVANSLMDGLVTMGVPEIRLVGPSSLLPDKVGNDSIKKFTELKPSLLNSDVIVTLRLQKERHDNSVDIDAF 240
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29655373  241 RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLELFLLRDFRFF 310
gi 161831597 241 RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLELFLLRDFRFF 310
gi 154705998 241 RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLELFLLRDFRFF 310
gi 212219593 241 RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLELFLLRDFRFF 310
gi 212213539 241 RGSFRLTPEKLYSAKPDAIVMHPGPVNREVEINSDVADNQQSVILQQVRNGVAMRMAVLELFLLRDFRFF 310
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap