Conserved Protein Domain Family
PRK13846

?
PRK13846: PRK13846 
putative glycerol-3-phosphate acyltransferase PlsX; Provisional
Statistics
?
PSSM-Id: 139906
View PSSM: PRK13846
Aligned: 14 rows
Threshold Bit Score: 562.125
Threshold Setting Gi: 15834816
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33242330    1 MEVQIGIDLMGGDHSPLVVWQVLVDVLKSQSSTIPFAFTLFASEEIRKQIqeefISDLPQEKFPKIISAENFVAMEDSPL 80
gi 29840564    1 MNVQIGIDLMGGDHSPLVIWEVLIDVLNSRASNSHISFIAFASREVKEQI----LSSYTHKEYPEIIASESFVAMDDSPL 76
gi 15605545    1 MKVRLGVDMMGGDHDPLVVWEALGEVLLSSTGEQPVEFTVFATSDVHHQ-----LMNSPLSRSVRIVTAEDFVSMEDSLL 75
gi 15834816    1 MKVRLGVDMMGGDHDPLVVWEALEEVLLSLDGQ-PVEFSVFATPDVHQQ-----LTHSPLSRSVQMIASESFVSMEDSVL 74
gi 15836495    1 MEVQIGIDLMGGDHSPLVVWQVLVDVLKSQSSTIPFAFTLFASEEIRKQIqeefISDLPQEKFPKIISAENFVAMEDSPL 80
gi 76789554    1 MKVRLGVDMMGGDHDPLVVWEALGEVLLSSIGEQPVEFTVFATSDVHHQ-----LMNSPLSRSVRIVTAEDFVSMEDSLL 75
gi 89898015    1 MNVQIGIDLMGGDHSPLVIWEVLIDVLNSTASNSHFSFTAFASHEVQEQI----LSSCTYKECPKIIASDSFVTMDDSPL 76
gi 62185382    1 MNVQIGIDLMGGDHSPLVIWEVLIDVLNSRASNSHISFTAFASHEVKEQI----LSHSTYKGYPEVIASESFITMEDSPL 76
gi 166155029   1 MKVRLGVDMMGGDHDPLVVWEALGEVLLSSTGEQPVEFTVFATSDVHHQ-----LMNSPLSRSVRIVTAEDFVSMEDSLL 75
gi 237803242   1 MKVRLGVDMMGGDHDPLVVWEALGEVLLSSIGEQPVEFTVFATSDVHHQ-----LMNSPLSRSVRIVTAEDFVSMEDSLL 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33242330   81 AAIRKKSSSMALGLDYLQEDKLDAFISTGNTGALVTLARAKIPLFPAVSRPALLVCVPTMRGHAVILDVGANISVKPEEM 160
gi 29840564   77 AAIRKKSSSMALGLDYLKEDKIDAFISTGNTAALITLSRAKIPVFPTVRRPALLVRVPTMRGCAVILDVGANVSVNPEEM 156
gi 15605545   76 AAVRKKRSSMALGLDALQQGDLDGFVSSGNTAALVTLARSKIPMIPAVPRPALLVSVPTLSGFAVILDVGATVSVNPDEM 155
gi 15834816   75 AAVRKKRSSMALGLDSLQRGELDGFISAGNTAALVTLARAKIPMIPAVPRPALLVSVPTLSGFAVILDVGATVAVNPEEM 154
gi 15836495   81 AAIRKKSSSMALGLDYLQEDKLDAFISTGNTGALVTLARAKIPLFPAVSRPALLVCVPTMRGHAVILDVGANISVKPEEM 160
gi 76789554   76 AAVRKKRSSMALGLDALQQGDLDGFVSSGNTAALVTLARSKIPMIPAVPRPALLVSVPTLSGFAVILDVGATVSVNPDEM 155
gi 89898015   77 SAIRKKSSSMALGLDYLKEDKIDAFISTGNTAALITLSRTKIPVFPTVRRPALLVRVPTMRGCAVILDVGANVSVNPEEM 156
gi 62185382   77 SAIRKKSSSMALGLDYLKEDKIDALISTGNTAALITLSRTKIPMFPTVRRPALLVRVPTMRGCAVILDVGANVSVNPEEM 156
gi 166155029  76 AAVRKKRSSMALGLDALQQGDLDGFVSSGNTAALVTLARSKIPMIPAVPRPALLVSVPTLSGFAVILDVGATVSVNPDEM 155
gi 237803242  76 AAVRKKRSSMALGLDALQQGDLDGFVSSGNTAALVTLARSKIPMIPAVPRPALLVSVPTLSGFAVILDVGATVSVNPDEM 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33242330  161 VGFARMGLAYRQCLGD--SKIPTIGLLNIGSEERKGTEAHRQTFRMLRETFGEAFLGNIESGAVFDGAADIVVTDGFTGN 238
gi 29840564  157 LGFARMGLAYRQCLGK--AECPTIGLLNIGSEERKGTEAHRQTYRILKETFQDAFLGNIESGDVFGGSVDIVVADGFTGN 234
gi 15605545  156 VGFARMGLAYRQSLSSnsNQPFTLGLLNIGSEERKGTDSHKQTFRMLRNIFGSAFLGNIESGDVFSGKVDIVVTDGFTGN 235
gi 15834816  155 VGFARMGLAYRQSLSSs-DQSFTLGLLNIGSEERKGTDSHKHTFRMLRDVFGSAFLGNVESGDVFSGKVDIVVTDGFTGN 233
gi 15836495  161 VGFARMGLAYRQCLGD--SKIPTIGLLNIGSEERKGTEAHRQTFRMLRETFGEAFLGNIESGAVFDGAADIVVTDGFTGN 238
gi 76789554  156 VGFARMGLAYRQSLSSnsNQPFTLGLLNIGSEERKGTDSHKQTFRMLRNIFGSAFLGNIESGDVFSGKVDIVVTDGFTGN 235
gi 89898015  157 LGFARMGLAYRQCIGE--KEHPTIGLLNIGSEERKGTEAHRQTFRILRETFQDSFLGNIESGDVFSGSVDIVVADGFTGN 234
gi 62185382  157 LGFARMGLAYKQCLGD--TEHPTVGLLNIGSEERKGTEAHRLTFRLLRETFQHAFLGNIESGDVFSGSVDVVVSDGFTGN 234
gi 166155029 156 VGFARMGLAYRQSLSSnsNQPFTLGLLNIGSEERKGTDSHKQTFRMLRNIFGSAFLGNIESGDVFSGKVDIVVTDGFTGN 235
gi 237803242 156 VGFARMGLAYRQSLSSnsNQPFTLGLLNIGSEERKGTDSHKQTFRMLRNIFGSAFLGNIESGDVFSGKVDIVVTDGFTGN 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33242330  239 IFLKTAEGVFEFLQRILGDKLEADIQRRLDYTFYPGSVVCGLSKLVIKCHGKACGSSLFHGILGSINLAQARLCKRILSN 318
gi 29840564  235 IFLKTAEGVFDFLRHILGDKLESDVTRHLDYTIYPGSMVCGLSKLVIKCHGKACGKSLFNGISGSIDLARARVCERILSS 314
gi 15605545  236 VFLKTAEGLFDFLRHILGDRLEKSIKMQFDYTIYPGSIISGLSRLVIKCHGKSHGTALFGGISGAIDLARANVCSRIADR 315
gi 15834816  234 VFLKTAEGLFDFLRHILGDHLEKTIKTRFDYTIYPGSIISGLSRLVIKCHGKSRETALFGGISGAVDLARSNVCGRIAAK 313
gi 15836495  239 IFLKTAEGVFEFLQRILGDKLEADIQRRLDYTFYPGSVVCGLSKLVIKCHGKACGSSLFHGILGSINLAQARLCKRILSN 318
gi 76789554  236 VFLKTAEGLFDFLRRILGDRLEKSIKMQFDYTIYPGSIISGLSRLVIKCHGKSHGTALFGGISGAIDLARANVCSRIADR 315
gi 89898015  235 IFLKTAEGVFDFLRHILGDKLESDVKRQLDYTIYPGSMVCGLSKLVIKCHGKACGRSLFNGISGSIDLARARVCQRILSS 314
gi 62185382  235 IFLKTAEGVFDFLSHILGDKLESDVKRQLDYTIYPGSMVCGLSKLVIKCHGKACGRSLFNGISGSIDLVRARVCERILSS 314
gi 166155029 236 VFLKTAEGLFDFLRHILGDRLEKSIKMQFDYTIYPGSIISGLSRLVIKCHGKSHGTALFGGISGAIDLARANVCSRIADR 315
gi 237803242 236 VFLKTAEGLFDFLRRILGDRLEKSIKMQFDYTIYPGSIISGLSRLVIKCHGKSHGTALFGGISGAIDLARANVCSRIADR 315

                 ..
gi 33242330  319 LI 320
gi 29840564  315 LS 316
gi 15605545  316 FG 317
gi 15834816  314 FG 315
gi 15836495  319 LI 320
gi 76789554  316 FG 317
gi 89898015  315 LS 316
gi 62185382  315 LS 316
gi 166155029 316 FG 317
gi 237803242 316 FG 317
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap