Conserved Protein Domain Family
PRK13853

?
PRK13853: PRK13853 
type IV secretion system protein VirB4; Provisional
Statistics
?
PSSM-Id: 139913
View PSSM: PRK13853
Aligned: 10 rows
Threshold Bit Score: 1388.81
Threshold Setting Gi: 148244027
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148244027   1 MPVNRIRAERSAERYLPYLGHVRPDILLMDDGSVLAMAEIPGAPYELAADADRAASLVTVNALCKNVADDNVTLHSAFVR 80
gi 150378123   1 MFGTNGRNERSGEIYLPYVGHLSDQVVLLEDGSVMAMAHVKGLPFEMEDVAIRNARCRAFNTLLRNIADDSVSICAHLVR 80
gi 190404468   1 MFGASGRTERSGEIYLPYVGHLSDHVVLLEDGSILTMAHISGLPFELEEVEVRNARCRAFNTLFRNIADDNVSVYAHLVR 80
gi 190014770   1 MLGASGTTERSGEIYLPYIGHLSDHIVLLEDGSIMTIARIDGVAFELEETEMRNARCRAFNTLLRNIADDHVSIYAHLVR 80
gi 86359750    1 MLGTSGTTERSGEVYLPYVGHLSDHIVLLEDGSIMTMAHISGVAFELEDAEMRNARCRAFNTLLRNIADDHVSLYAHLVR 80
gi 10954802    1 MFGASGRTERSGEIYLPYVGHLSDHVVLLEDGSILTMAHISGLPFELEEVEVRNARCRAFNTLFRNIADDNVSVYAHLVR 80
gi 10954964    1 MLGASGTTERSGEVYLPYVGHLSDHIVLLEDGSIMTMAHVSGMAFELEDAEMRNARCRAFNTLLRNIADDHVSIYAHLVR 80
gi 10955146    1 MLGASGTTERSGEIYLPYIGHLSDHIVLLEDGSIMSIARIDGVAFELEEIEMRNARCRAFNTLLRNIADDHVSIYAHLVR 80
gi 16119786    1 MLGASGTTERSGEVYLPYVGHVSDHIVLLEDGSIMTMAHVSGMAFELEDAEMRNARCRAFNTLLRNIADDHVSIYAHLVR 80
gi 222080245   1 MFGANGRTERSGEIYLPYVGHLSDHIVLLEDGSILTMAHISGLPFELEEVEVRNARCRAFNTLFRNIADDNVSVYAHLVR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148244027  81 GPGAGQLAHAVMPNEFAASLDRAYRERVLAGRLYQNTWYLTVIVSPRNPLGGKAGGATaslfggKRERQKPHATAEGIRQ 160
gi 150378123  81 HNDVALPPARHFHSGFAGSLSEAYERRVLSGKLFRNDHFLTLVVFPRTAVGKITGRFI------KRNNRNENDLANQTRN 154
gi 190404468  81 HNDVPVPPVRHFRSTFASSLSETFERRVLSGKLFRNDHFLTLIVSPRTTLGKVGSRFT------RRYGKNPGDLAHQIRH 154
gi 190014770  81 HADVPSSAPRHFRSVFAASLNEAFEQRVLSGQLLRNEHFLTLIVYPQAALGKVKRRFT------KLSGKRENDLTGQIRN 154
gi 86359750   81 HDDVSPAPARHFRSAFSASLSGAFEQRVLCGQLLRNDHFLTLMVFPRTALGKVKRKFA------KLYMKKENELAGQIRH 154
gi 10954802   81 HNDVPVPPVRHFRSTFASSLSETFERRVLSGKLFRNDHFLTLIVSPRTALGKVGSRFT------RRYGKNPGDLAHQIRH 154
gi 10954964   81 HDDVPPSPARHFRSAFSASLSEAFEERVLSGKLLRNDHFLTLIVSPRAALGKVRRRFT------KRYRQKENDLTAQTRN 154
gi 10955146   81 HADVPSSAPRHFRSVFAASLNEAFEQRVLSGQLLRNDHFLTLIVYPQAALGKVKRRFT------KLSGKRENDLAGQIRN 154
gi 16119786   81 HDDVPPSPARHFRSAFSASLSEAFEERVLSGKLLRNDHFLTLIVSPRAALGKVRRRFT------KRYRQKENDLTAQTRN 154
gi 222080245  81 HSDVPAPPVRHFRSAFASSLSETFEQRVLSGKLFRNDHFLTLIVSPRTALGKVRSRFT------TRYGKNLGDLAHQIRH 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148244027 161 LEEVWQTISQTLAPYDVRRLGLRpaANGQFYFSEIAEALRLILTGTAAPVPLVSGPLGAALYTDRAIFGRRVFELRGPGV 240
gi 150378123 155 LEDLWHITSGALDAYGLRRLGLR--EKDGVIFSEIAEALRLIMTCRATPVPVVSGSLGASIYTDRVICGKRALEIRTPGD 232
gi 190404468 155 LEDLWNVVAGALDGYGLRRLGIR--EKNQVLFTEIGEALRLIMTCRFLPVPVVSGSLGASVYTDRVICGKRALEIRAPKD 232
gi 190014770 155 MEDLWHVVAGSLKAYGLHRLGIR--EKQGVLFTEIGEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKD 232
gi 86359750  155 LEDLWHVVAGALEEYGLRRLGVR--EKQDVLFSEVGEALRLVMTGRFAPVPVVSGSLGASIYTDRVICGKRGIEIRTPKE 232
gi 10954802  155 LEDLWNVVAGTLDGYGLRRLGIR--EKNQVLFTEIGEALRLIMTCRFLPVPVVSGSLGASVYTDRVICGKRALEIRAPKD 232
gi 10954964  155 LEDLWHLVAGALEAYGLRRLGIR--EKQDVLFTEVGEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKD 232
gi 10955146  155 MEDLWHVVAGSLKAYGLHRLGIR--EKQGVLFTEIGEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKD 232
gi 16119786  155 LEDLWHLVAGALEAYGLRRLGIR--EKQDVLFTEVGEALRLIMTGRFTPVPVVSGSLGASIYTDRVICGKRGLEIRTPKD 232
gi 222080245 155 LEDLWNIVAGALDGYGLRRLGIR--EKNQVLFTEIGEALRLIMTCRFLPVPVVSGSLGAAVYTDRVICGKRALEIRAPKD 232
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148244027 241 SRFGAIFGYREYPSETYAGMYDGVFSLPCPVVMVHTFDFHARHTSEKRLGLKAAQMTAANDKARSQISDLADAQDHLASG 320
gi 150378123 233 SYVGSLFSFREYPAKTRPGMLNPLLSANFPLVLSQSFSFLTRAQAHAKLSLKSSQMTSSGDKAVSQINELAEAEDALASS 312
gi 190404468 233 RYVGSIFSFREYPAKTRPGMLNTLLSSSFPLVLSQSFSFLTRAQAHAKLSLKSNQMTSSGDKAVTQIGELAQAEDSLASS 312
gi 190014770 233 SYVGSIYSFREYPAKTRPGMLNALLSLDFPLVLTQSFSFLTRPQAHAKLSLKSSQMLSSGDKAVTQIGKLSEAEDALASN 312
gi 86359750  233 SYVGSIYSFREYPARTRPGMLNTLLSLDFPIVLTQSFSFLTRAQAHAKLSLKSRQMLSSGDKAVTQISELAEAEDALASN 312
gi 10954802  233 RYVGSIFSFREYPAKTRPGMLNTLLSSSFPLVLSQSFSFLTRAQAHAKLSLKSNQMTSSGDKAVTQIGELAQAEDSLASS 312
gi 10954964  233 SYVGSIYSFREYPATTRPGMLNVLLSLDFPLVLTQSFSFLTRSQAHSKLSLKSSQMLSSGDKAVTQISKLSEAEDALASN 312
gi 10955146  233 SYVGSIYSFREYPAKTRPGMLNALLSLDFPLVLTQSFSFLTRPQAHAKLSLKSSQMLSSGDKAVTQIGKLSEAEDALASN 312
gi 16119786  233 SYVGSIYSFREYPATTRPGMLNVLLSLDFPLVLTQSFSFLTRSQAHSKLSLKSSQMLSSGDKAVTQISKLSEAEDALASN 312
gi 222080245 233 RYVGSIFSFREYPAKTRPGMLNILLLSSFPLVLSQSFSFLTRAQSHAKLSLKSNQMTSSGDKAVTQIGELAQAEDSLASS 312
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148244027 321 KIAMGEHHFSLTVYADTIEELDRLSGLTRTVIANSGGVVAQESAGLEAAYFAQLPGNRKWRTRPGTITTRNFAAFSGFEA 400
gi 150378123 313 EFVMGAHHLSLCVYADDLNSLANRAASARTRLTDAGAVIVQEGIGMEAAYWAQLPGNTKWRTRPGAITSRNFAGLVSFEN 392
gi 190404468 313 EFVMGSHHLSLCVYGDDLDTLADYGARARTSLSDAGAVIVQESIGMEAAYWSQLPGNHRWRTRPGAITSRNFAGLVSFEN 392
gi 190014770 313 EFVMGSHHLSLCVYADDLNSLGDRGARARTRMADAGAVVVQEGIGMEAAYWSQLPGNFKWRTRPGAITSRNFAGFVSFEN 392
gi 86359750  313 QFVMGSHHLSLCIYAKDLESLADKGARARTRLADAGAVVVQEGIGMEAAYWSQLPGNCRWRTRPGAINSRNFAGLVSFEN 392
gi 10954802  313 EFVMGSHHLSLCVYGDDLDTLADYGARARTSLSDAGAVIVQESIGMEAAYWSQLPGNHRWRTRPGAITSRNFAGLVSFEN 392
gi 10954964  313 EFVMGAHHVSLCIYANDLNSLADRGARARTRLADAGAVVVQEGIGMEAAYWSQLPGNYKWRTRPGAITSRNFAGLVSFEN 392
gi 10955146  313 EFVMGSHHLSLCVYADDLNSLGDRGARARTRMADAGAVVVQEGIGMEAAYWSQLPGNFKWRTRPGAITSRNFAGFVSFEN 392
gi 16119786  313 EFVLGAHHVSLCIYANDLNNLADRGARARTRLADAGAVVVQEGIGMEAAYWSQLPGNYKWRTRPGAITSRNFAGLVSFEN 392
gi 222080245 313 EFVMGSHHLSLCVYADDLDTLADYGARARTSLSDAGAVIVQESIGMEAAYWSQFPGNHRWRTRPGAITSRNFAGLVSFEN 392
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148244027 401 FPRGQRAGKWGPAMARFRTTAGTAYDYVPHVEDVGMTAIFGKIGQGKTTFMLFLLALFPQYFAARNGAVVFFDKDRGGEL 480
gi 150378123 393 FPSGKDSGHWGNSVARFRTNGGTPFDYLPHENDVGMTAIFGPVGKGKTTLMTFVLAMLEQSMVGHDGAIVFFDKDRGGEL 472
gi 190404468 393 FPIGRKSGHWGGAVARFRTNGGTPFDYIPHENDVGMTAIFGPIGRGKTTLMTFILAMLEQSVVDRSGTIVFFDKDRGGEL 472
gi 190014770 393 FPEGASSGHWGNAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMMFVLAMLEQSMVDRAGTVVFFDKDRGGEL 472
gi 86359750  393 YPEGARSGHWGDAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMTFILAMLEQSMLEREGAVVFFDKDRGGEL 472
gi 10954802  393 FPIGRKSGHWGGAVARFRTNGGTPFDYIPHENDVGMTAIFGPIGRGKTTLMTFILAMLEQSVVDRSGTIVFFDKDRGGEL 472
gi 10954964  393 FPEGSGSGHWGNAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMTFILAMLEQSMVDRAGAVVLFDKDRGSEL 472
gi 10955146  393 FPEGASSGHWGTAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMMFVLAMLEQSMVDRAGTVVFFDKDRGGEL 472
gi 16119786  393 FPEGSGSGHWGNAIARFRTNGGTPFDYIPHEHDVGMTAIFGPIGRGKTTLMTFILAMLEQSMVDRAGAVVLFDKDRGSEL 472
gi 222080245 393 FPIGRKSGHWGGAVARFRTNGGTPFDYIPHENDVGMTAIFGPIGRGKTTLMTFILAMLEQSMAGRSGTIVFFDKDRGGEL 472
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148244027 481 LCRAVGGRYLVVRAGRDSGLAPLKALDNTPESVAFLVQWLTALIQQDGHGPLPPEDDARLTRGVQALLRLAPDMRSLAGL 560
gi 150378123 473 LVRATGGTYLALRRGVPSGLAPLRALDDTSASRDFLREWVTALIESDGRGAISPEENRRLERAIVRQLSFEPAMRSLAGL 552
gi 190404468 473 LVRATGGTYLTLRRGVPSGLAPLRGLEDTAAARDFLREWIVALIESDGRGGISPEENRRLERGIQRQLSFEPNMRSLAGL 552
gi 190014770 473 LVRATGGTYLALHRGTPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPQMRSIAGL 552
gi 86359750  473 LVRATGGTYLALRRGVPSGLAPLRGLENTAASRDFLREWLVALIESDGRGGISPEENRRLVRGIHRQLSFDPPMRSIAGL 552
gi 10954802  473 LVRATGGTYLTLRRGVPSGLAPLRGLEDTAAARDFLREWIVALIESDGRGGISPEENRRLERGIQRQLSFEPNMRSLAGL 552
gi 10954964  473 LVRATGGTYLALRRGAPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPHMRSIAGL 552
gi 10955146  473 LVRATGGTYLALRRGTPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPQMRSIAGL 552
gi 16119786  473 LVRATGGTYLALRRGAPSGLAPLRGLENTAASHDFLREWIVALIESDGRGGISPEENRRLVRGIHRQLSFDPHMRSIAGL 552
gi 222080245 473 LVRATGGTYLTLRRGVPSGLAPLRGLEDTAAARDFLREWIVALIESDGRGGISPEENRRLERGIQRQLSFEPNMRSLAGL 552
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148244027 561 RQFLDWRNPMGAGARLERWCKGGSLGWAFDGERDDVSLEATTVGFDLTAILDNGTVCAPAANYLLYRISQALDGRRFVLS 640
gi 150378123 553 REFLLHSPSEGAGARLERWCRGNALGWAFDGEVDEVRLHASITGFDMTQILEYEEVCAPAAAYLLHRVGAVVDGRRFVMC 632
gi 190404468 553 REFLLHGPSEGAGARLQRWCRGNALGWAFDGESDEVKLDPSITGFDMTHLLEYEEVCAPAAAYLLHRIGAMVDGRRFVMS 632
gi 190014770 553 REFLLHGPAEGAGARLQRWCRGHALGWAFDGEVDEVKLDPSITGFDMTHLLEYEEVCAPAAAYLLHRIGAMIDGRRFVMS 632
gi 86359750  553 REFLLHGPAEGAGARLQRWCRGNALGWAFDGELDDVRLDPSITGFDMTHLLEYEEVCAPAAAYLLHRIGALLDGRRFVMS 632
gi 10954802  553 REFLLHGPSEGAGARLQRWCRGNALGWAFDGESDEVNLDPSITGFDMTHLLEYGEVCAPAAAYLLHRIGAMVDGRRFVMS 632
gi 10954964  553 REFLLHGPAEGAGARLQRWCRGNALGWAFDGELDEVKLDPSITGFDMTHLLEYEEVCAAAAAYLLHRIGAMVDGRRFVMS 632
gi 10955146  553 REFLLHGPAEGAGARLQRWCRGHALGWAFDGEVDEVKLDPSITGFDMTHLLEYEEVCAPAAAYLLHRIGAMIDGRRFVMS 632
gi 16119786  553 REFLLHGPAEGAGARLQRWCRGNALGWAFDGELDEVKLDPSITGFDMTHLLEYEEVCAAAAAYLLHRIGAMVDGRRFVMS 632
gi 222080245 553 REFLLHGPSEGAGARLQRWCRGNALGWAFDGESDEVKLDPSITGFDMTHLLDYEEVCAPAAAYLLHRIGAMVDGRRFVMS 632
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148244027 641 CDEFNFYLLNPLFAKIWADFMLTVRKSNAVVLLATQEPAPVLDSPQGDSILRQCQTLVFCPTPGAEEHLYRKRLNFTAGE 720
gi 150378123 633 CDEFRFYLLNPQFAAVVDKFLLTVRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRSAYVGGLKCTEGE 712
gi 190404468 633 CDEFRSYLLNQKFAAVVDKFLLTVRKNNGMLVLATQQPEHVLDSPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTERE 712
gi 190014770 633 CDEFRAYLLNPKFSTVVDKFLLTVRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRSAYVDGLKCTEKE 712
gi 86359750  633 CDEFRAYLLNPKFSAVIDKFLLTVRKNNGMLILATQQPEHVLESQLGASLVAQCMTKIFYPSPTANRSAYIDGLKCTEKE 712
gi 10954802  633 CDEFRSYLLNQKFAAVVDKFLLTVRKNNGMLVLATQQPEHVLDSPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTERE 712
gi 10954964  633 CDEFRAYLLNPKFAAVVDKFLLTVRKNNGMLILATQQPEHVLESQLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKE 712
gi 10955146  633 CDEFRAYLLNPKFSAVVDKFLLTVRKNNGMLILATQQPEHVLESPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKE 712
gi 16119786  633 CDEFRAYLLNPKFAAVVDKFLLTVRKNNGMLILATQQPEHVLESQLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTEKE 712
gi 222080245 633 CDEFRAYLLNQKFAAVVDKFLLTVRKNNGMLILATQQPEHVLDSPLGASLVAQCMTKIFYPSPTADRSAYIDGLKCTERE 712
                        730       740       750       760       770       780       790
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 148244027 721 FRAIAEDMLPNSRQLLIKRHGGSAIIDFDLSALPEFVAILSSRKSSVGFVEQLRATHGDDPAAWLPAFMARFHEEVE 797
gi 150378123 713 YQAVREQMAIGSRKFLLKRESGSVICEFDLGEMREYVAVLSGRANTVRFADQLRARHGDAPGAWVDEFMARYQEVQD 789
gi 190404468 713 FQAIREEMAIGSRKFLLKRESGSVVCEFDLRDMPEYVAVLSGRANTVRFAQQLRETHGEEPSAWLEKFMTRYHEAQD 789
gi 190014770 713 FQAIREDMTVGSRKFLLKRESGSVICEFDLRDMREYVAVLSGRANTVRFATRLREAQEGNSSGWLSEFMARHHEAED 789
gi 86359750  713 FQAIREEMAVGNRKFLLKRESGSVICEFDLREMREYIAVLSGRANTVRFADQLREARGEDPSAWLSEFMNRYHEAKD 789
gi 10954802  713 FQAIREEMAIGSRKFLLKRESGSVVCEFDLRDMPEYVAVLSGRANTVRFAQQLRETHGEEPSAWLEKFMTRYHEAQD 789
gi 10954964  713 FQAIREDMAVGSRKFLLKRESGSVVCEFDLREMREYVAVLSGRANTVRFADQLRKVQGDNPSAWLSEFMARYHEAKD 789
gi 10955146  713 FQAIREDMTVGSRKFLLKRESGSVICEFDLRDMREYVAVLSGRANTVRFAARLREAQEGNSSGWLSEFMARHHEAED 789
gi 16119786  713 FQAIREDMAVGSRKFLLKRESGSVVCEFDLREMREYVAVLSGRANTVRFADQLRKVQGDNPSAWLSEFMARYHEAKD 789
gi 222080245 713 FQAIREDMAIGSRKFLLKRESGSVVCEFDLRDMSEYVAVLSGRANTVRFAQQLRETCGEDPSAWLDEFMTRYREAQD 789
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap